StarFunc result for job id A0A2R8YFR7

User Input

>input (1487 residues)
VEAEEAQRGASPPISAIEEFSIIPEAPMRSSQVSALGLEAQEDEDPSYKWREEHRLSATQ
QSELRDVCDYAIETMPSFPKEGSADVEPNQESLVAEACDTPEHWEAVPQSLAGRQARTLA
PPELWACPIQSEHLDMAPFSSDLGSEEEEVEFWPGLTSLTLGSGQAEEEEETSSDNSGQT
RYYSPCEEHPAETNQNEGSESGTIRQGEELPPEELQESQGLLHPQEVQVLEEQGQQEAGF
RGEGTLREDVCADGLLGEEQMIEQVNDEKGEQKQKQEQVQDVMLGRQGERMGLTGEPEGL
NDGEWEQEDMERKAQGQGGPEQGEERKRELQVPEENRADSQDEKSQIFLGKSEEVTGKQE
DHGIKEKGVPVSGQEAKEPESWDGGRLGAVGRARSREEENEHHGPSMPALIAPEDSPHCD
LFPGASYLMTQIPGTQTESRAEELSPAALSPSLEPIRCSHQPISLLGSFLTEESPDKEID
QNSQQEGSRLRKGTVSSQGTEVVFASASVTPPRTPDSAPPSPAEAYPITPASVSARPPVA
FPRRETSCAARAPETASAPLSMDDPSPCGTSEMCPAALYGFPSTGTSPPRPPANSTGTVQ
HLRSDSFPGSHRTEQTPDLVGMLLSYSHSELPQRPPKPAIYSSVTPRRDRRSGRDYSTVS
ASPTALSTLKQDSQESISNLERPSSPPSIQPWVSPHNPAFATESPAYGSSPSFVSMEDVR
IHEPLPPPPPQRRDTHPSVVETDGHARVVVPTLKQHSHPPPLALGSGLHAPHKGPLPQAS
DPAVARQHRPLPSTPDSSHHAQATPRWRYNKPLPPTPDLPQPHLPPISAPGSSRIYRPLP
PLPIIDPPTEPPPLPPKSRGRSRSTRGGHMNSGGHAKTRPACQDWTVPLPASAGRTSWPP
ATARSTESFTSTSRSKSEVSPGMAFSNMTNFLCPSSPTTPWTPELQGPTSKDEAGVSEHP
EAPAREPLRRTTPQQGASGPGRSPVGQARQPEKPSHLHLEKASSWPHRRDSGRPPGDSSG
QAVAPSEGANKHKGWSRQGLRRPSILPEGSSDSRGPAVEKHPGPSDTVVFREKKPKEVMG
GFSRRCSKLINSSQLLYQEYSDVVLNKEIQSQQRLESLSETPGPSSPRQPRKALVSSESY
LQRLSMASSGSLWQEIPVVRNSTVLLSMTHEDQKLQEVKFELIVSEASYLRSLNIAVDHF
QLSTSLRATLSNQEHQWLFSRLQDVRDVSATFLSDLEENFENNIFSFQVCDVVLNHAPDF
RRVYLPYVTNQTYQERTFQSLMNSNSNFREVLEKLESDPVCQRLSLKSFLILPFQRITRL
KLLLQNILKRTQPGSSEEAEATKAHHALEQLIRDCNNNVQSMRRTEELIYLSQKIEFECK
IFPLISQSRWLVKSGELTALEFSASPGLRRKLNTRPVHLHLFNDCLLLSRPREGSRFLVF
DHAPFSSIRGEKCEMKLHGPHKNLFRLFLRQNTQGAQAEFLFRTETQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q12774	0.303	0.283	0.000	1597	0.997	0.929	Q12774.pdb.gz	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
2	AFDB:E9Q7D5	0.280	0.265	1.023E-96	1581	0.617	0.581	E9Q7D5.pdb.gz	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
3	AFDB:A1ZAN6	0.190	0.114	1.125E-16	2559	0.168	0.098	A1ZAN6.pdb.gz	A1ZAN6_DROME Rho guanine nucleotide exchange factor 2, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGEF2 PE=1 SV=1
4	AFDB:Q96PE2	0.178	0.132	2.748E-15	2063	0.159	0.115	Q96PE2.pdb.gz	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
5	AFDB:Q9VW85	0.200	0.180	4.871E-15	1661	0.159	0.143	Q9VW85.pdb.gz	Q9VW85_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG13812 PE=1 SV=4
6	AFDB:Q6ZNL6	0.130	0.132	1.391E-14	1462	0.153	0.155	Q6ZNL6.pdb.gz	FGD5_HUMAN FYVE, RhoGEF and PH domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FGD5 PE=1 SV=3
7	AFDB:M9PHU0	0.199	0.136	2.586E-14	2263	0.143	0.094	M9PHU0.pdb.gz	M9PHU0_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG12432 PE=1 SV=1
8	PDB:4mt6A	0.159	0.486	1.023E-13	389	0.037	0.141	4mt6A.pdb.gz
9	PDB:7rx9A	0.119	0.393	2.622E-12	432	0.044	0.150	7rx9A.pdb.gz
10	AFDB:Q9VZ85	0.172	0.132	2.099E-9	1984	0.169	0.127	Q9VZ85.pdb.gz	Q9VZ85_DROME Rho guanine nucleotide exchange factor at 64C, isoform A OS=Drosophila melanogaster OX=7227 GN=RhoGEF64C PE=4 SV=2
11	PDB:4gouA	0.115	0.320	6.775E-8	507	0.031	0.091	4gouA.pdb.gz
12	AFDB:Q9JL04	0.062	0.059	2.379E-4	1578	0.163	0.154	Q9JL04.pdb.gz	FMN2_MOUSE Formin-2 OS=Mus musculus OX=10090 GN=Fmn2 PE=1 SV=2
13	AFDB:Q9NZ56	0.048	0.045	3.019E-4	1722	0.163	0.141	Q9NZ56.pdb.gz	FMN2_HUMAN Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4
14	PDB:5yqrA	0.061	0.269	8.160E-4	268	0.021	0.116	5yqrA.pdb.gz
15	PDB:6u3eA	0.068	0.191	1.812E-2	397	0.030	0.111	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
16	PDB:6xtbE	0.052	0.256	4.276E-2	235	0.009	0.060	6xtbE.pdb.gz
17	PDB:1k5dB	0.056	0.387	5.970E-2	146	0.009	0.096	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
18	PDB:7ph3A	0.052	0.105	6.568E-2	577	0.026	0.066	7ph3A.pdb.gz	The ABC transporter MsbA adopts the wide inward-open conformation in E. coli cells.
19	PDB:3m1iB	0.056	0.391	1.009E-1	131	0.007	0.076	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
20	PDB:1lw3A	0.051	0.138	2.381E-1	513	0.009	0.025	1lw3A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A090N7S2	0.0	847	519	0.275	0.788	A0A090N7S2_HUMAN Rho guanine nucleotide exchange factor (GEF) 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=4 SV=1
2	E9Q7D5	0.0	1611	1581	0.630	0.593	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
3	H0Y895	0.0	1402	797	0.461	0.861	H0Y895_HUMAN Rho guanine nucleotide exchange factor 5 (Fragment) OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=1
4	Q12774	0.0	3011	1597	0.998	0.929	ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3
5	E7EY47	6.39e-120	402	958	0.146	0.227	E7EY47_DANRE Rho guanine nucleotide exchange factor (GEF) 19 OS=Danio rerio OX=7955 GN=arhgef19 PE=4 SV=1
6	Q8BWA8	1.10e-118	394	802	0.146	0.271	ARHGJ_MOUSE Rho guanine nucleotide exchange factor 19 OS=Mus musculus OX=10090 GN=Arhgef19 PE=1 SV=1
7	Q8IW93	3.30e-118	392	802	0.146	0.271	ARHGJ_HUMAN Rho guanine nucleotide exchange factor 19 OS=Homo sapiens OX=9606 GN=ARHGEF19 PE=1 SV=1
8	Q5I1Y9	2.01e-86	295	533	0.117	0.326	Q5I1Y9_CHICK Ephexin1 OS=Gallus gallus OX=9031 PE=2 SV=1
9	Q5BKC9	5.03e-83	290	701	0.118	0.250	NGEF_RAT Ephexin-1 OS=Rattus norvegicus OX=10116 GN=Ngef PE=1 SV=2
10	Q8N5V2	5.37e-81	285	710	0.116	0.242	NGEF_HUMAN Ephexin-1 OS=Homo sapiens OX=9606 GN=NGEF PE=1 SV=2
11	Q8CHT1	8.71e-80	281	710	0.102	0.213	NGEF_MOUSE Ephexin-1 OS=Mus musculus OX=10090 GN=Ngef PE=1 SV=1
12	Q5VV41	4.38e-61	226	709	0.096	0.202	ARHGG_HUMAN Rho guanine nucleotide exchange factor 16 OS=Homo sapiens OX=9606 GN=ARHGEF16 PE=1 SV=1
13	A0A0G2JTU0	8.16e-58	218	850	0.110	0.193	A0A0G2JTU0_RAT Rho guanine nucleotide exchange factor 15 OS=Rattus norvegicus OX=10116 GN=Arhgef15 PE=1 SV=1
14	D3YYY8	1.16e-57	218	869	0.082	0.140	D3YYY8_MOUSE Rho guanine nucleotide exchange factor (GEF) 26 OS=Mus musculus OX=10090 GN=Arhgef26 PE=1 SV=1
15	Q5FWH6	1.61e-57	218	849	0.110	0.193	ARHGF_MOUSE Rho guanine nucleotide exchange factor 15 OS=Mus musculus OX=10090 GN=Arhgef15 PE=1 SV=1
16	Q96DR7	2.76e-57	217	871	0.083	0.142	ARHGQ_HUMAN Rho guanine nucleotide exchange factor 26 OS=Homo sapiens OX=9606 GN=ARHGEF26 PE=1 SV=4
17	O94989	2.22e-56	214	841	0.104	0.184	ARHGF_HUMAN Rho guanine nucleotide exchange factor 15 OS=Homo sapiens OX=9606 GN=ARHGEF15 PE=1 SV=4
18	D3ZPJ8	1.61e-52	199	670	0.090	0.200	D3ZPJ8_RAT Rho guanine nucleotide exchange factor 15 OS=Rattus norvegicus OX=10116 GN=Arhgef15 PE=1 SV=1
19	Q9Y150	1.11e-41	169	1051	0.074	0.105	Q9Y150_DROME BcDNA.GH03693 OS=Drosophila melanogaster OX=7227 GN=Exn PE=2 SV=1
20	Q9VVC6	3.67e-41	169	2029	0.074	0.054	Q9VVC6_DROME Ephexin, isoform D OS=Drosophila melanogaster OX=7227 GN=Exn PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15441 ARHGEF5_35	1e-221	748.8	RhoGEF 5/35 N-terminal disordered region
2	PF00621 RhoGEF	5.9e-33	126.1	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000056217

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.965	Transforming protein RhoA
2	9606.ENSP00000371897	0.935	Rho GTPase-activating protein 5
3	9606.ENSP00000275364	0.917	Guanine nucleotide-binding protein subunit alpha-12
4	9606.ENSP00000348461	0.917	Ras-related C3 botulinum toxin substrate 1
5	9606.ENSP00000286548	0.907	Guanine nucleotide-binding protein G(q) subunit alpha
6	9606.ENSP00000248572	0.906	Guanine nucleotide-binding protein G(T) subunit gamma-T1
7	9606.ENSP00000400717	0.906	Guanine nucleotide-binding protein subunit alpha-13
8	9606.ENSP00000481878	0.901	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
9	9606.ENSP00000379401	0.677	Odontogenic ameloblast-associated protein
10	9606.ENSP00000250617	0.625	Rho guanine nucleotide exchange factor 6
11	9606.ENSP00000347710	0.584	Oligophrenin-1
12	9606.ENSP00000366826	0.562	Ankyrin repeat domain-containing protein 20A2
13	9606.ENSP00000373347	0.554	SLIT-ROBO Rho GTPase-activating protein 3
14	9606.ENSP00000339467	0.552	Rho-related GTP-binding protein RhoG
15	9606.ENSP00000264644	0.536	Rap guanine nucleotide exchange factor-like 1
16	9606.ENSP00000298694	0.535	Rho guanine nucleotide exchange factor 40
17	9606.ENSP00000387020	0.518	Rho guanine nucleotide exchange factor 33
18	9606.ENSP00000404232	0.507	EF-hand domain-containing family member C2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0097159	0.858	organic cyclic compound binding
GO:1901363	0.857	heterocyclic compound binding
GO:0043167	0.836	ion binding
GO:1901265	0.812	nucleoside phosphate binding
GO:0043168	0.783	anion binding
GO:0036094	0.781	small molecule binding
GO:0097367	0.772	carbohydrate derivative binding
GO:0000166	0.752	nucleotide binding
GO:0032553	0.744	ribonucleotide binding
GO:0035639	0.735	purine ribonucleoside triphosphate binding
GO:0017076	0.730	purine nucleotide binding
GO:0032555	0.723	purine ribonucleotide binding
GO:0019001	0.695	guanyl nucleotide binding
GO:0005525	0.683	GTP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050794	0.993	regulation of cellular process
GO:0023051	0.969	regulation of signaling
GO:0010646	0.969	regulation of cell communication
GO:0048583	0.964	regulation of response to stimulus
GO:1902531	0.948	regulation of intracellular signal transduction
GO:0048522	0.932	positive regulation of cellular process
GO:0051128	0.819	regulation of cellular component organization
GO:0051056	0.811	regulation of small GTPase mediated signal transduction
GO:0050790	0.763	regulation of catalytic activity
GO:0044093	0.762	positive regulation of molecular function
GO:0009987	0.753	cellular process
GO:0050896	0.622	response to stimulus
GO:0043085	0.572	positive regulation of catalytic activity
GO:0051336	0.550	regulation of hydrolase activity
GO:0019222	0.500	regulation of metabolic process
GO:0051171	0.492	regulation of nitrogen compound metabolic process
GO:0031323	0.492	regulation of cellular metabolic process
GO:0080090	0.489	regulation of primary metabolic process
GO:0010638	0.483	positive regulation of organelle organization
GO:0060255	0.482	regulation of macromolecule metabolic process
GO:0044089	0.481	positive regulation of cellular component biogenesis
GO:0043087	0.428	regulation of GTPase activity
GO:0019220	0.369	regulation of phosphate metabolic process
GO:0031399	0.343	regulation of protein modification process
GO:0051716	0.312	cellular response to stimulus
GO:0051492	0.306	regulation of stress fiber assembly
GO:0009893	0.303	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005829	0.999	cytosol
GO:0005654	0.995	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]