StarFunc result for job id A0A2Z4LIS9

User Input

>input (290 residues)
METDLAEMPEKGVLSSQDSPHFQEKSTEEGEVAALRLTARSQAAAAAAAPGSRSLRGVHV
PPPLHPAPAREESARTPAAAGRAAKMAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPL
QRPELQASPAKPSGETAADSMIPEEEDDEDDEDGGGRAGSAMAIGGGGGSRTLVSGLLLE
DSVRVLAPGGQDPGSGPATAAGGLSGGTQALLQPQQPLPPPQPGAAGGSGQPRKCSSRRN
AWGNLSYADLITRAIESSPDRRLTLSQIYEWMVSCVPYFKDKGNSNSSAG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15353	0.135	0.065	1.723E-1	648	0.231	0.103	O15353.pdb.gz	FOXN1_HUMAN Forkhead box protein N1 OS=Homo sapiens OX=9606 GN=FOXN1 PE=1 SV=1
2	AFDB:D4A1T1	0.135	0.091	4.625E-1	474	0.207	0.127	D4A1T1.pdb.gz	D4A1T1_RAT Forkhead box N1 OS=Rattus norvegicus OX=10116 GN=Foxn1 PE=4 SV=4
3	AFDB:Q53QW1	0.129	0.099	1.798	395	0.176	0.129	Q53QW1.pdb.gz	TEX44_HUMAN Testis-expressed protein 44 OS=Homo sapiens OX=9606 GN=TEX44 PE=1 SV=1
4	AFDB:Q84TK1	0.109	0.077	2.302	458	0.159	0.100	Q84TK1.pdb.gz	BH010_ARATH Transcription factor bHLH10 OS=Arabidopsis thaliana OX=3702 GN=BHLH10 PE=1 SV=1
5	PDB:7acoB	0.068	0.105	3.610	180	0.045	0.072	7acoB.pdb.gz
6	AFDB:Q04047	0.093	0.051	4.268	700	0.148	0.061	Q04047.pdb.gz	NONA_DROME Protein no-on-transient A OS=Drosophila melanogaster OX=7227 GN=nonA PE=1 SV=2
7	AFDB:Q9VK71	0.104	0.047	4.268	893	0.190	0.062	Q9VK71.pdb.gz	PDM2B_DROME POU domain protein 2, isoform B OS=Drosophila melanogaster OX=7227 GN=pdm2 PE=2 SV=2
8	PDB:2rvqD	0.099	0.173	5.228	129	0.038	0.085	2rvqD.pdb.gz
9	PDB:6wgcD	0.087	0.061	5.228	436	0.017	0.011	6wgcD.pdb.gz	Structural mechanism of helicase loading onto replication origin DNA by ORC-Cdc6.
10	AFDB:Q5NB28	0.117	0.093	5.811	406	0.128	0.091	Q5NB28.pdb.gz	Q5NB28_ORYSJ Os01g0230200 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0230200 PE=2 SV=1
11	AFDB:Q69Y51	0.106	0.083	5.811	401	0.159	0.115	Q69Y51.pdb.gz	Q69Y51_ORYSJ BHLH transcription factor PTF1 OS=Oryza sativa subsp. japonica OX=39947 GN=P0698A06.26-2 PE=3 SV=1
12	PDB:7edxm	0.110	0.271	5.915	87	0.014	0.046	7edxm.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
13	PDB:7pzyO	0.107	0.188	5.915	150	0.045	0.087	7pzyO.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
14	AFDB:B2RX14	0.095	0.026	6.574	1644	0.124	0.022	B2RX14.pdb.gz	TUT4_MOUSE Terminal uridylyltransferase 4 OS=Mus musculus OX=10090 GN=Tut4 PE=1 SV=2
15	PDB:1psrA	0.090	0.202	6.692	100	0.024	0.070	1psrA.pdb.gz
16	PDB:5jm0A	0.091	0.032	7.118	940	0.024	0.007	5jm0A.pdb.gz
17	AFDB:Q5VR96	0.099	0.073	7.438	437	0.145	0.096	Q5VR96.pdb.gz	Q5VR96_ORYSJ Os06g0275600 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os06g0275600 PE=3 SV=1
18	PDB:2m0rA	0.103	0.230	8.054	104	0.028	0.077	2m0rA.pdb.gz
19	PDB:2bykD	0.096	0.222	8.566	92	0.024	0.076	2bykD.pdb.gz
20	PDB:3hmxB	0.063	0.089	8.566	176	0.041	0.068	3hmxB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O43524	9.28e-138	405	673	0.686	0.296	FOXO3_HUMAN Forkhead box protein O3 OS=Homo sapiens OX=9606 GN=FOXO3 PE=1 SV=1
2	Q9WVH4	6.33e-100	308	672	0.634	0.274	FOXO3_MOUSE Forkhead box protein O3 OS=Mus musculus OX=10090 GN=Foxo3 PE=1 SV=1
3	D3ZBQ1	7.20e-100	308	672	0.624	0.269	D3ZBQ1_RAT Forkhead box O3 OS=Rattus norvegicus OX=10116 GN=Foxo3 PE=1 SV=1
4	A3RK75	1.70e-40	150	629	0.310	0.143	FX1AB_DANRE Forkhead box protein O1-B OS=Danio rerio OX=7955 GN=foxo1b PE=2 SV=1
5	Q5I0F7	4.52e-40	149	643	0.317	0.143	Q5I0F7_DANRE Forkhead box O3A OS=Danio rerio OX=7955 GN=fb50g02 PE=2 SV=1
6	Q9W7F8	1.51e-39	148	651	0.338	0.151	Q9W7F8_DANRE Forkhead box protein O3 OS=Danio rerio OX=7955 GN=fkhr PE=2 SV=1
7	F1RME6	4.37e-37	141	662	0.397	0.174	F1RME6_PIG Forkhead box protein O1 OS=Sus scrofa OX=9823 GN=FOXO1 PE=4 SV=2
8	A4L7N3	4.81e-36	138	662	0.359	0.157	FOXO1_PIG Forkhead box protein O1 OS=Sus scrofa OX=9823 GN=FOXO1 PE=2 SV=1
9	G3V7R4	1.81e-34	134	649	0.355	0.159	FOXO1_RAT Forkhead box protein O1 OS=Rattus norvegicus OX=10116 GN=Foxo1 PE=1 SV=1
10	P98177	3.05e-31	123	505	0.279	0.160	FOXO4_HUMAN Forkhead box protein O4 OS=Homo sapiens OX=9606 GN=FOXO4 PE=1 SV=5
11	F1NNE8	5.37e-30	121	660	0.179	0.079	F1NNE8_CHICK Forkhead box O3 OS=Gallus gallus OX=9031 GN=FOXO3 PE=2 SV=4
12	Q9WVH3	1.12e-26	110	505	0.176	0.101	FOXO4_MOUSE Forkhead box protein O4 OS=Mus musculus OX=10090 GN=Foxo4 PE=1 SV=1
13	Q12778	6.16e-26	109	655	0.179	0.079	FOXO1_HUMAN Forkhead box protein O1 OS=Homo sapiens OX=9606 GN=FOXO1 PE=1 SV=2
14	D4A433	1.25e-25	107	505	0.172	0.099	D4A433_RAT Forkhead box O4 OS=Rattus norvegicus OX=10116 GN=Foxo4 PE=1 SV=1
15	A8MYZ6	1.58e-25	107	492	0.166	0.098	FOXO6_HUMAN Forkhead box protein O6 OS=Homo sapiens OX=9606 GN=FOXO6 PE=1 SV=1
16	A3RK74	1.87e-25	107	652	0.166	0.074	FX1AA_DANRE Forkhead box protein O1-A OS=Danio rerio OX=7955 GN=foxo1a PE=2 SV=1
17	Q70KY4	2.21e-25	107	559	0.166	0.086	FOXO6_MOUSE Forkhead box protein O6 OS=Mus musculus OX=10090 GN=Foxo6 PE=1 SV=1
18	Q9R1E0	3.16e-25	107	652	0.176	0.078	FOXO1_MOUSE Forkhead box protein O1 OS=Mus musculus OX=10090 GN=Foxo1 PE=1 SV=2
19	Q95V55	1.13e-24	105	613	0.179	0.085	FOXO_DROME Forkhead box protein O OS=Drosophila melanogaster OX=7227 GN=foxo PE=1 SV=1
20	B3G3K1	1.04e-23	102	584	0.152	0.075	B3G3K1_ANCCA Forkhead transcription factor DAF-16 OS=Ancylostoma caninum OX=29170 GN=daf16 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	9.4e-07	40.2	Forkhead domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385824

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000212015	0.999	NAD-dependent protein deacetylase sirtuin-1
2	9606.ENSP00000266970	0.999	Cyclin-dependent kinase 2
3	9606.ENSP00000344456	0.999	Catenin beta-1
4	9606.ENSP00000372191	0.999	NAD-dependent protein deacetylase sirtuin-3, mitochondrial
5	9606.ENSP00000379287	0.999	14-3-3 protein zeta/delta
6	9606.ENSP00000451828	0.999	RAC-alpha serine/threonine-protein kinase
7	9606.ENSP00000258149	0.997	E3 ubiquitin-protein ligase Mdm2
8	9606.ENSP00000269305	0.997	Cellular tumor antigen p53
9	9606.ENSP00000263253	0.996	Histone acetyltransferase p300
10	9606.ENSP00000479618	0.996	Myc proto-oncogene protein
11	9606.ENSP00000341551	0.995	Mothers against decapentaplegic homolog 4
12	9606.ENSP00000262160	0.993	Mothers against decapentaplegic homolog 2
13	9606.ENSP00000361930	0.993	14-3-3 protein beta/alpha
14	9606.ENSP00000375892	0.993	RAC-beta serine/threonine-protein kinase
15	9606.ENSP00000376943	0.993	Bcl-2-like protein 11
16	9606.ENSP00000263826	0.992	RAC-gamma serine/threonine-protein kinase
17	9606.ENSP00000264335	0.992	14-3-3 protein epsilon
18	9606.ENSP00000264867	0.992	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
19	9606.ENSP00000278616	0.990	Serine-protein kinase ATM
20	9606.ENSP00000332973	0.989	Mothers against decapentaplegic homolog 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.989	heterocyclic compound binding
GO:0097159	0.989	organic cyclic compound binding
GO:0003677	0.978	DNA binding
GO:0043565	0.917	sequence-specific DNA binding
GO:0140110	0.846	transcription regulator activity
GO:0003700	0.840	DNA-binding transcription factor activity
GO:1990837	0.524	sequence-specific double-stranded DNA binding
GO:0000981	0.345	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.943	regulation of biological process
GO:0050794	0.897	regulation of cellular process
GO:0060255	0.815	regulation of macromolecule metabolic process
GO:0031323	0.808	regulation of cellular metabolic process
GO:0080090	0.772	regulation of primary metabolic process
GO:0051171	0.767	regulation of nitrogen compound metabolic process
GO:0009889	0.766	regulation of biosynthetic process
GO:0010468	0.749	regulation of gene expression
GO:0006355	0.705	regulation of DNA-templated transcription
GO:0009987	0.652	cellular process
GO:0048519	0.414	negative regulation of biological process
GO:0032502	0.394	developmental process
GO:0048518	0.375	positive regulation of biological process
GO:0032501	0.358	multicellular organismal process
GO:0048856	0.347	anatomical structure development
GO:0048522	0.326	positive regulation of cellular process
GO:0048523	0.313	negative regulation of cellular process
GO:0006357	0.302	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.997	intracellular organelle lumen
GO:0005654	0.993	nucleoplasm
GO:0005737	0.473	cytoplasm
GO:0005829	0.373	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]