StarFunc result for job id A0A3B3IT33

User Input

>input (452 residues)
MNSGILQVFQRELICPICMNYFIDPVTIDCGHSFCRPCFYLNWQDMAVLAQCSKCKKTTR
QRNLKTNICLKNMASIARKASLRQFLSSEEQICGTHRETKEMFCEVDKSLLCLLCSNSQE
HRNHRHCPTEWAAEERREELLRKMQSLWRKMCENHRNLNMATNRIRCWKDYVSLRIEAIR
AEYHKMVAFFHEEEQRHLERLQKEGEDIFQQLNESKARMEHSRELLRGMYEDLRQMCHKA
VVELFQSFGDILQRYESLLLQVSEPVNPEFSAGPIIGLMDRLKGFRVYLTLQHARASSHI
FLHGDLRSMKVGCDPQHDPNITDKSECFLQWGADFFISGKFYWEFNMGHSWNWAFGVCNN
YWKEKRQNDMIDGEVGLFLLGCVKEDTHCSLFTTSPLVMQYVPRPTDTVGLFLDCEGRTV
SFVDVDRSSLIYTIPNCSFSPPLWPIICCSHF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0CI25	0.500	0.500	8.383E-56	452	0.708	0.708	P0CI25.pdb.gz	TRI49_HUMAN Tripartite motif-containing protein 49 OS=Homo sapiens OX=9606 GN=TRIM49 PE=1 SV=1
2	AFDB:Q96BQ3	0.781	0.790	1.519E-48	446	0.493	0.500	Q96BQ3.pdb.gz	TRI43_HUMAN Tripartite motif-containing protein 43 OS=Homo sapiens OX=9606 GN=TRIM43 PE=1 SV=1
3	AFDB:Q96F44	0.565	0.547	2.657E-30	468	0.299	0.288	Q96F44.pdb.gz	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
4	AFDB:Q99PQ2	0.523	0.508	3.934E-30	467	0.290	0.281	Q99PQ2.pdb.gz	TRI11_MOUSE E3 ubiquitin-protein ligase TRIM11 OS=Mus musculus OX=10090 GN=Trim11 PE=1 SV=1
5	AFDB:Q495X7	0.387	0.373	4.401E-30	471	0.259	0.248	Q495X7.pdb.gz	TRI60_HUMAN Tripartite motif-containing protein 60 OS=Homo sapiens OX=9606 GN=TRIM60 PE=1 SV=2
6	AFDB:Q62191	0.536	0.518	2.367E-29	470	0.272	0.262	Q62191.pdb.gz	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
7	AFDB:A0A024RCR1	0.363	0.338	3.314E-29	488	0.283	0.262	A0A024RCR1.pdb.gz
8	AFDB:P19474	0.558	0.533	1.347E-28	475	0.290	0.276	P19474.pdb.gz	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
9	AFDB:Q8BGE7	0.318	0.297	1.347E-28	488	0.270	0.250	Q8BGE7.pdb.gz	TRIM6_MOUSE Tripartite motif-containing protein 6 OS=Mus musculus OX=10090 GN=Trim6 PE=1 SV=1
10	AFDB:Q9BYJ4	0.347	0.327	1.347E-28	488	0.270	0.250	Q9BYJ4.pdb.gz	TRI34_HUMAN E3 ubiquitin-protein ligase TRIM34 OS=Homo sapiens OX=9606 GN=TRIM34 PE=1 SV=2
11	PDB:7y4sA	0.301	0.387	1.698E-11	343	0.144	0.190	7y4sA.pdb.gz
12	PDB:4b3nA	0.308	0.254	1.790E-10	557	0.113	0.092	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
13	PDB:7z36B	0.203	0.205	1.417E-7	446	0.113	0.114	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
14	PDB:4tn3B	0.268	0.321	1.580E-6	362	0.111	0.138	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
15	PDB:7ccbA	0.234	0.575	3.653E-5	164	0.046	0.128	7ccbA.pdb.gz
16	PDB:7nscA	0.266	0.410	1.484E-4	276	0.051	0.083	7nscA.pdb.gz
17	PDB:6swy1	0.252	0.214	2.325E-4	542	0.091	0.076	6swy1.pdb.gz
18	PDB:7tdgA	0.209	0.026	4.556E-4	4134	0.049	0.005	7tdgA.pdb.gz	Ca 2+ -inactivation of the mammalian ryanodine receptor type 1 in a lipidic environment revealed by cryo-EM.
19	PDB:7nsba	0.216	0.175	7.136E-4	568	0.060	0.048	7nsba.pdb.gz
20	PDB:7u9tA	0.227	0.031	1.323E-3	4229	0.046	0.005	7u9tA.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0CI25	0.0	654	452	0.708	0.708	TRI49_HUMAN Tripartite motif-containing protein 49 OS=Homo sapiens OX=9606 GN=TRIM49 PE=1 SV=1
2	P0CI26	0.0	652	452	0.708	0.708	TR49C_HUMAN Tripartite motif-containing protein 49C OS=Homo sapiens OX=9606 GN=TRIM49C PE=1 SV=1
3	Q96BQ3	3.26e-151	439	446	0.493	0.500	TRI43_HUMAN Tripartite motif-containing protein 43 OS=Homo sapiens OX=9606 GN=TRIM43 PE=1 SV=1
4	Q8IWZ4	2.79e-84	260	224	0.296	0.598	TRI48_HUMAN E3 ubiquitin-protein ligase TRIM48 OS=Homo sapiens OX=9606 GN=TRIM48 PE=1 SV=3
5	P19474	2.32e-61	209	475	0.305	0.291	RO52_HUMAN E3 ubiquitin-protein ligase TRIM21 OS=Homo sapiens OX=9606 GN=TRIM21 PE=1 SV=1
6	Q3U7K7	5.18e-55	191	462	0.288	0.281	Q3U7K7_MOUSE RING-type E3 ubiquitin transferase OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
7	Q62191	5.33e-55	192	470	0.288	0.277	RO52_MOUSE E3 ubiquitin-protein ligase TRIM21 OS=Mus musculus OX=10090 GN=Trim21 PE=1 SV=1
8	Q96F44	1.33e-52	185	468	0.299	0.288	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
9	Q99PQ2	2.43e-52	184	467	0.294	0.285	TRI11_MOUSE E3 ubiquitin-protein ligase TRIM11 OS=Mus musculus OX=10090 GN=Trim11 PE=1 SV=1
10	Q8BGE7	1.46e-51	183	488	0.285	0.264	TRIM6_MOUSE Tripartite motif-containing protein 6 OS=Mus musculus OX=10090 GN=Trim6 PE=1 SV=1
11	Q8BVP1	1.51e-51	182	470	0.292	0.281	TRIML_MOUSE Probable E3 ubiquitin-protein ligase TRIML1 OS=Mus musculus OX=10090 GN=Triml1 PE=1 SV=1
12	Q587N6	5.16e-49	176	495	0.281	0.257	TRIM5_MACFA Tripartite motif-containing protein 5 OS=Macaca fascicularis OX=9541 GN=TRIM5 PE=2 SV=1
13	Q9C030	8.83e-49	175	488	0.270	0.250	TRIM6_HUMAN Tripartite motif-containing protein 6 OS=Homo sapiens OX=9606 GN=TRIM6 PE=1 SV=1
14	A0A024RCP5	2.39e-48	175	518	0.292	0.255	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
15	Q9HCM9	2.39e-48	175	518	0.292	0.255	TRI39_HUMAN E3 ubiquitin-protein ligase TRIM39 OS=Homo sapiens OX=9606 GN=TRIM39 PE=1 SV=2
16	Q9C035	4.40e-48	174	493	0.310	0.284	TRIM5_HUMAN Tripartite motif-containing protein 5 OS=Homo sapiens OX=9606 GN=TRIM5 PE=1 SV=1
17	Q0PF16	5.99e-48	173	497	0.279	0.254	TRIM5_MACMU Tripartite motif-containing protein 5 OS=Macaca mulatta OX=9544 GN=TRIM5 PE=1 SV=2
18	Q6AZZ1	1.64e-46	169	485	0.272	0.254	TRI68_HUMAN E3 ubiquitin-protein ligase TRIM68 OS=Homo sapiens OX=9606 GN=TRIM68 PE=1 SV=1
19	Q5C8U3	3.30e-46	169	515	0.279	0.245	TRIM5_CHLTN Tripartite motif-containing protein 5 OS=Chlorocebus tantalus OX=60712 GN=TRIM5 PE=2 SV=1
20	Q9Y577	5.39e-46	167	477	0.283	0.268	TRI17_HUMAN E3 ubiquitin-protein ligase TRIM17 OS=Homo sapiens OX=9606 GN=TRIM17 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01442 Apolipoprotein	6.8e+02	11.5	Apolipoprotein A1/A4/E domain
2	PF19756 DUF6243	59	15.3	Family of unknown function (DUF6243)
3	PF09425 Jas_motif	6.8e+02	11.6	Jas motif
4	PF00622 SPRY	0.001	30.6	SPRY domain
5	PF00643 zf-B_box	0.22	23.0	B-box zinc finger
6	PF00097 zf-C3HC4	0.00076	30.6	Zinc finger, C3HC4 type (RING finger)
7	PF13923 zf-C3HC4_2	0.0077	27.3	Zinc finger, C3HC4 type (RING finger)
8	PF13920 zf-C3HC4_3	19	16.5	Zinc finger, C3HC4 type (RING finger)
9	PF15227 zf-C3HC4_4	1.9e-06	39.2	zinc finger of C3HC4-type, RING
10	PF16685 zf-RING_10	29	16.2	zinc RING finger of MSL2
11	PF13639 zf-RING_2	3.4	19.4	Ring finger domain
12	PF14634 zf-RING_5	20	16.5	zinc-RING finger domain
13	PF13445 zf-RING_UBOX	6.6e-05	34.2	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000006229

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000033419	0.700	Tripartite motif containing 56
2	9598.ENSPTRP00000020204	0.561	Uncharacterized protein
3	9598.ENSPTRP00000003188	0.559	Solute carrier family 45, member 3
4	9598.ENSPTRP00000026701	0.555	Uncharacterized protein
5	9598.ENSPTRP00000033733	0.505	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0140096	0.667	catalytic activity, acting on a protein
GO:0016740	0.599	transferase activity
GO:0004842	0.348	ubiquitin-protein transferase activity
GO:0003676	0.318	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0050896	0.913	response to stimulus
GO:0050794	0.887	regulation of cellular process
GO:0048518	0.736	positive regulation of biological process
GO:0009987	0.580	cellular process
GO:0048522	0.537	positive regulation of cellular process
GO:0009605	0.498	response to external stimulus
GO:0019222	0.482	regulation of metabolic process
GO:0071704	0.448	organic substance metabolic process
GO:0010468	0.436	regulation of gene expression
GO:0044238	0.430	primary metabolic process
GO:0006807	0.419	nitrogen compound metabolic process
GO:0048583	0.419	regulation of response to stimulus
GO:0044419	0.407	biological process involved in interspecies interaction between organisms
GO:0043207	0.403	response to external biotic stimulus
GO:0051707	0.391	response to other organism
GO:0043170	0.382	macromolecule metabolic process
GO:1901564	0.376	organonitrogen compound metabolic process
GO:0019538	0.370	protein metabolic process
GO:0006950	0.355	response to stress
GO:0009966	0.348	regulation of signal transduction
GO:0032446	0.348	protein modification by small protein conjugation
GO:0016567	0.340	protein ubiquitination
GO:0048584	0.336	positive regulation of response to stimulus
GO:0010647	0.336	positive regulation of cell communication
GO:0023056	0.335	positive regulation of signaling
GO:0009967	0.334	positive regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.901	cytosol
GO:0043226	0.660	organelle
GO:0043229	0.587	intracellular organelle
GO:0043227	0.426	membrane-bounded organelle
GO:0043231	0.357	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.599	Transferases.

[back to server]