StarFunc result for job id A0A494C071

User Input

>input (2061 residues)
MDSEYVLCSWKGRLWPAKVLCTRGTSPKTKPEKAISLEVQILAVDEKIKVKSTDVKTPTK
FEMEDIAASAAAQTKLGAPLREKMGYRGTLRVALEILKERTNLGGGRKPHELESTTPSQL
SQKVPEKPASSVPREDDWRCKGDLRRSLGKRENPSSPTVPSESKRALRDDRSQEPTAIAP
TPGALPGDRSGAPRAIAPTPGAMLSGRSRARRAIAPTPSALRGYRSWAHRAIAPTPGCLY
SDRSRAHRAIAPARGTKHGGRSWACRSIAPKPGSLCGDRSQASRAIDPTLGARRGGRSRA
HRAIAPTPGSLCGNRSRACGAIALTPGVLCGVRSRVPKDITPTPGALRGYKSWVCRAIAP
TPGALRGDRSAARTAVVRTPGALGRDRSRARSAIASTPGTLQGNRSSVSKAIAPTPGALR
GDRSAARTAFVPTPGALHRDRSRARSAIASTPGTLRGNTSSACKAIAPTPGALRGYKSWA
RRAIAPNPGAWRGYRSTTGTAIAPNLGALGGNRSAARTDIAPTPGALRGYRSWTRRAIAP
TPGTLSSYRSRSRRTIASTPATLRGEKSRAHTSLAPTPGALRGDGSRARRAIVPTTCPLC
EIWSRVGIGIAPIADALRRDRSPVRRAIAPTPGTLSGYRSRARTAIAPTPGTLRGYRPRS
RRAIASTPATLRGEKSRAHTSLAPAPGALRGDGSRARRAIVPTTCPLCEIWSRVGIGIAP
IADALRRDRPPVRRAIAPTPGALRCDRSRELTAIDPTPGALCSDRSGASRAIAPTPGTLC
SERSRVRRAIAPTPCALCGKGSQVGMGVAPTPGALRRDRSQAGRAIAPTPSALFRVGSRV
GTGIALPAGALHRDRSPVRRAVAPTPGTLHCDGSRKCTATGSTPGALPGDRSGVSKATAP
APGALCSERSRARRSIAPTPCLLCGDRSWVGMGIAPTPGALLGGKSRKCRAIAITPGALR
GGRSQKRRVVAPTPEALHGDGSWTYMAIAPTPGALHGDSSPAHTSIIPSPGALHGDGPPA
HMAFPSTPGTLHGDASHAHMAIAPTPGTMRGDSSTARTATAPSPGALRGDRSWKRKAIAS
TPGALHGNRSDRSRKCKAIASTPGTLHVERSPALRAIVPTPGTLGRDSSPGRTSIIPSPG
ALHGDRSPAHLDIASTPGALHGDSSQAHTAIAPTPGTMRGDSSTARMAIAPSAGALRGDR
SWKRKAIASTPGALRGNRSDRSRKRKAIASTPGALLGNRSDRSRKHKAIAPTPGAPRIDR
SPACRAIAPTPGALGDDSSTAIAPTPGTPRGDSSPANTAIASTPGALHGDTSQTHKAIAP
TPGDLGGGSSSAHKAITPSPGALHGDRSPAHTAIASTPGALHGDSSQVHTTIAPTPGALR
DDKSWKRKAIAPTPGTLHCDSSRTCTAFAPTPGALHADRSPAHQDITLTSGALHCDSSRE
SRAVAPILGALHRVGSQAHKAIASTPGPLRGDSSPFHTAIAPMPGALHGTRSWKREAISQ
TPFVTLCGDSSGERMAIAPTPGALHSDRSQTHTAIDPTPSVLRSDSSPACMAIDPTPGAL
GRDRSQALMAIAPTPVGMQAHVLQSPRACQDSLTLSRHVCEKKGKKRANASTLMSLPPTV
TEEGASLPPGLTSPAPPALKEETQDSRPKKALAASPESSPFSGNIQDPGEGAWKPGWAGM
AASSGSRQHRLPSSLRLANRKRKRPGPDFQRRPQGPQTPGDAKLANPVTTIQRAGGKQDG
QPPSLAFPQEPHPIERGTMVWFKFQDHPFWPAVVKSVSNTDKTARVLLLEANLHHGKRGI
QVPLRRLKHLDCKEKEKLLKRAQKAYKQSVNWCFSLISHYREGLVRGSFRGSFLDYYAAD
ISYPIRRAIQEGDLQIDFPKVNYGDLEDWEEETSLGGKRPCKKILPDRMRASWDRDNQKL
VDFIVRRKGADPHLLDILQGRKQSRWLTAFLKPHRDLHCIETYLEDDDQLEVVAKHLQEI
YKQIDKARLTLIRDDKVNFVLEVLLPEAMICTIAALDGLDYKAAEEKYLRGPPVHYREKE
LFDRNILKKARREPATTHTAN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9VTR6	0.097	0.108	1.140E-5	1713	0.102	0.123	Q9VTR6.pdb.gz	Q9VTR6_DROME Pericardin OS=Drosophila melanogaster OX=7227 GN=prc PE=1 SV=2
2	AFDB:H9GXF8	0.039	0.055	9.042E-2	1248	0.040	0.067	H9GXF8.pdb.gz
3	PDB:7e29A	0.032	0.121	1.523E-1	496	0.010	0.040	7e29A.pdb.gz	H3K36 methylation and DNA-binding both promote Ioc4 recruitment and Isw1b remodeler function.
4	AFDB:A0A024QZE0	0.030	0.088	2.404E-1	651	0.027	0.084	A0A024QZE0.pdb.gz
5	PDB:5aj0AM	0.030	0.341	3.391E-1	139	0.009	0.137	5aj0AM.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
6	PDB:5mc6h	0.037	0.052	3.391E-1	1121	0.023	0.043	5mc6h.pdb.gz	The cryo-EM structure of a ribosome-Ski2-Ski3-Ski8 helicase complex.
7	PDB:7kimM	0.033	0.297	4.050E-1	135	0.008	0.119	7kimM.pdb.gz	Structural basis of transcriptional activation by the Mycobacterium tuberculosis intrinsic antibiotic-resistance transcription factor WhiB7.
8	PDB:3mp8A	0.023	0.087	4.839E-1	513	0.005	0.021	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
9	PDB:4zn3A	0.028	0.336	6.043E-1	147	0.006	0.088	4zn3A.pdb.gz	Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
10	PDB:4pa0B	0.019	0.043	6.905E-1	920	0.003	0.008	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
11	PDB:6s01K	0.028	0.542	7.219E-1	86	0.005	0.128	6s01K.pdb.gz	Structure of H3K36-methylated nucleosome-PWWP complex reveals multivalent cross-gyre binding.
12	PDB:5ikjA	0.024	0.099	9.425E-1	448	0.004	0.020	5ikjA.pdb.gz	SHREC Silences Heterochromatin via Distinct Remodeling and Deacetylation Modules.
13	AFDB:Q9C0Y2	0.041	0.051	1.245	1220	0.062	0.105	Q9C0Y2.pdb.gz	YKL1_SCHPO Putative cell agglutination protein SPAPB2C8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAPB2C8.01 PE=3 SV=1
14	PDB:4pa0A	0.019	0.038	1.287	974	0.003	0.007	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
15	AFDB:Q61282	0.064	0.063	2.030	2132	0.085	0.082	Q61282.pdb.gz	PGCA_MOUSE Aggrecan core protein OS=Mus musculus OX=10090 GN=Acan PE=1 SV=2
16	AFDB:Q9JKC9	0.029	0.038	2.030	1329	0.054	0.084	Q9JKC9.pdb.gz	SYNRG_RAT Synergin gamma OS=Rattus norvegicus OX=10116 GN=Synrg PE=1 SV=3
17	AFDB:A0A2R8RNK4	0.027	0.031	2.425	1718	0.063	0.076	A0A2R8RNK4.pdb.gz
18	AFDB:O15013	0.026	0.036	2.425	1369	0.041	0.062	O15013.pdb.gz	ARHGA_HUMAN Rho guanine nucleotide exchange factor 10 OS=Homo sapiens OX=9606 GN=ARHGEF10 PE=1 SV=4
19	AFDB:P40357	0.025	0.056	2.425	651	0.038	0.120	P40357.pdb.gz	SEC9_YEAST Protein transport protein SEC9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC9 PE=1 SV=1
20	AFDB:O43303	0.026	0.042	2.771	1012	0.043	0.087	O43303.pdb.gz	CP110_HUMAN Centriolar coiled-coil protein of 110 kDa OS=Homo sapiens OX=9606 GN=CCP110 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5H9M0	5.82e-121	401	696	0.109	0.323	PWP3B_HUMAN PWWP domain-containing DNA repair factor 3B OS=Homo sapiens OX=9606 GN=PWWP3B PE=2 SV=1
2	Q2TAK8	6.07e-99	338	710	0.079	0.228	PWP3A_HUMAN PWWP domain-containing DNA repair factor 3A OS=Homo sapiens OX=9606 GN=PWWP3A PE=1 SV=3
3	J3KNX4	6.71e-99	338	711	0.079	0.228	J3KNX4_HUMAN PWWP domain containing 3A, DNA repair factor OS=Homo sapiens OX=9606 GN=PWWP3A PE=1 SV=1
4	A0A0D9SGJ8	2.91e-80	284	732	0.068	0.193	A0A0D9SGJ8_HUMAN PWWP domain containing 3A, DNA repair factor OS=Homo sapiens OX=9606 GN=PWWP3A PE=1 SV=1
5	K7EP97	4.40e-25	108	263	0.036	0.285	K7EP97_HUMAN PWWP domain-containing DNA repair factor 3A (Fragment) OS=Homo sapiens OX=9606 GN=PWWP3A PE=1 SV=4
6	A2ARZ3	5.35e-04	47.8	6995	0.017	0.005	FSIP2_MOUSE Fibrous sheath-interacting protein 2 OS=Mus musculus OX=10090 GN=Fsip2 PE=1 SV=3
7	M9PC48	0.049	41.6	18095	0.025	0.003	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
8	M9PCJ6	0.049	41.6	18641	0.025	0.003	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
9	Q586W1	0.26	38.9	1238	0.012	0.019	Q586W1_TRYB2 LIM zinc-binding domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=28H13.375 PE=4 SV=1
10	P14650	0.49	38.1	914	0.019	0.043	PERT_RAT Thyroid peroxidase OS=Rattus norvegicus OX=10116 GN=Tpo PE=2 SV=1
11	A2ASS6	1.7	36.2	35213	0.018	0.001	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
12	Q9UEW3	2.1	35.8	520	0.020	0.081	MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens OX=9606 GN=MARCO PE=1 SV=1
13	Q62433	4.3	34.7	394	0.008	0.043	NDRG1_MOUSE Protein NDRG1 OS=Mus musculus OX=10090 GN=Ndrg1 PE=1 SV=1
14	Q9V4C9	4.6	34.7	1140	0.016	0.029	Q9V4C9_DROME Datilografo, isoform B OS=Drosophila melanogaster OX=7227 GN=dati PE=4 SV=3
15	M9PCX6	4.8	34.7	1448	0.068	0.097	M9PCX6_DROME Uncharacterized protein, isoform N OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
16	F1NSM7	5.3	34.7	743	0.012	0.032	OC116_CHICK Ovocleidin-116 OS=Gallus gallus OX=9031 PE=1 SV=1
17	M9PF71	5.3	34.7	1516	0.083	0.113	M9PF71_DROME Uncharacterized protein, isoform O OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8086 PE=4 SV=1
18	A0A0J9YXN7	8.5	33.9	1372	0.035	0.053	A0A0J9YXN7_HUMAN Perilipin 4 OS=Homo sapiens OX=9606 GN=PLIN4 PE=1 SV=1
19	A0A8I5ZUN3	9.5	33.9	35375	0.013	0.001	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20074 DUF6470	32	15.7	Family of unknown function (DUF6470)
2	PF00855 PWWP	0.92	21.4	PWWP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 10090.ENSMUSP00000085806

Rank	PPI partner	STRING score	Description
1	10090.ENSMUSP00000136624	0.699	Predicted gene 13277
2	10090.ENSMUSP00000105141	0.686	Cytochrome P450, family 2, subfamily d, polypeptide 34
3	10090.ENSMUSP00000135952	0.635	Predicted gene 13289
4	10090.ENSMUSP00000137618	0.635	Predicted gene 13278
5	10090.ENSMUSP00000139768	0.635	Predicted gene 13283
6	10090.ENSMUSP00000095725	0.610	Receptor for interleukin-11. The receptor systems for IL6, LIF, OSM, CNTF, IL11 and CT1 can utilize IL6ST for initiating signal transmission. The IL11/IL11RA/IL6ST complex may be involved in the control of proliferation and/or differentiation of skeletogenic progenitor or other mesenchymal cells
7	10090.ENSMUSP00000137393	0.610	Interleukin-11 receptor subunit alpha-2
8	10090.ENSMUSP00000139043	0.591	Protein PET117 homolog, mitochondrial
9	10090.ENSMUSP00000048125	0.583	Sperm-associated antigen 11
10	10090.ENSMUSP00000002837	0.529	Transmembrane emp24 domain-containing protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.541	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0043229	0.978	intracellular organelle
GO:0043231	0.957	intracellular membrane-bounded organelle
GO:0005737	0.864	cytoplasm
GO:0005634	0.795	nucleus
GO:0031974	0.717	membrane-enclosed lumen
GO:0070013	0.628	intracellular organelle lumen
GO:0031981	0.620	nuclear lumen
GO:0005654	0.567	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]