StarFunc result for job id A0A494C086

User Input

>input (402 residues)
MDRTETRFRKRGQITGKITTSRQLHPQNEQSPQRSTSGYPLQEVVDDEVLGPSAPGVDPS
PPCRSLGWKRKKEWSDESEEEPEKELAPEPEETWVVETLCGLKMKLKQQRVSPILPEHHK
DFNSQLAPGVDPSPPHRSFCWKRKREWWDESEESLEEEPRKVLAPEPEEIWVAEMLCGLK
MKLKRRRVLLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIVYFSRAGLPS
WQYQRIHFFLALYLANDMEEDDEDSKQNIFHFLYGKTRSRIPLLRKRWFQLGRSMNPRAR
KNRSRIPLLRKRRFQLGRSMNPRARKYRSRIPLVRKRRFQLRRCMNPRARKNRSQIVLFQ
KLRFQFFCSMSGRAWVSPEELEEIQAYDPEHWVWARDRAHLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0CI01	0.474	0.474	3.579E-51	402	0.943	0.943	P0CI01.pdb.gz	SPDE6_HUMAN Speedy protein E6 OS=Homo sapiens OX=9606 GN=SPDYE6 PE=1 SV=2
2	AFDB:P0DTA3	0.416	0.609	6.818E-28	265	0.555	0.842	P0DTA3.pdb.gz	SPD11_HUMAN Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1
3	AFDB:A6NLX3	0.357	0.595	4.175E-21	237	0.423	0.717	A6NLX3.pdb.gz	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
4	AFDB:Q5IBH6	0.348	0.518	3.490E-19	268	0.346	0.519	Q5IBH6.pdb.gz	SPE4A_MOUSE Speedy protein E4A OS=Mus musculus OX=10090 GN=Spdye4a PE=1 SV=1
5	AFDB:Q16630	0.100	0.079	2.583E-1	551	0.134	0.098	Q16630.pdb.gz	CPSF6_HUMAN Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6 PE=1 SV=2
6	AFDB:P97499	0.070	0.021	4.976E-1	2629	0.090	0.014	P97499.pdb.gz	TEP1_MOUSE Telomerase protein component 1 OS=Mus musculus OX=10090 GN=Tep1 PE=1 SV=1
7	AFDB:Q14678	0.094	0.039	7.705E-1	1352	0.107	0.032	Q14678.pdb.gz	KANK1_HUMAN KN motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens OX=9606 GN=KANK1 PE=1 SV=3
8	AFDB:O74547	0.091	0.087	9.077E-1	422	0.132	0.126	O74547.pdb.gz	BIT61_SCHPO Target of rapamycin complex 2 subunit bit61 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bit61 PE=1 SV=1
9	AFDB:P11075	0.084	0.025	9.077E-1	2009	0.112	0.022	P11075.pdb.gz	SEC7_YEAST Protein transport protein SEC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC7 PE=1 SV=2
10	AFDB:F1NW90	0.079	0.047	1.069	823	0.132	0.064	F1NW90.pdb.gz	F1NW90_CHICK Neural precursor cell expressed, developmentally down-regulated 9 OS=Gallus gallus OX=9031 GN=NEDD9 PE=3 SV=4
11	PDB:1s56B	0.088	0.214	2.397	135	0.035	0.104	1s56B.pdb.gz	Heme-ligand tunneling in group I truncated hemoglobins
12	PDB:4b7sA	0.098	0.099	2.674	397	0.045	0.045	4b7sA.pdb.gz	Directing Group-Controlled Regioselectivity in an Enzymatic C-H Bond Oxygenation.
13	PDB:3g33B	0.105	0.156	2.982	229	0.067	0.118	3g33B.pdb.gz
14	PDB:6upnA	0.099	0.143	3.150	245	0.050	0.082	6upnA.pdb.gz
15	PDB:1sqfA	0.131	0.125	3.327	425	0.027	0.026	1sqfA.pdb.gz	The First Structure of an RNA m5C Methyltransferase, Fmu, Provides Insight into Catalytic Mechanism and Specific Binding of RNA Substrate
16	PDB:3hajA	0.083	0.108	3.711	286	0.065	0.091	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
17	PDB:6kvgA	0.129	0.193	4.140	256	0.030	0.047	6kvgA.pdb.gz
18	PDB:7egdD	0.070	0.123	4.372	197	0.070	0.142	7egdD.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
19	PDB:2w96A	0.149	0.225	4.618	249	0.027	0.044	2w96A.pdb.gz
20	PDB:7xufA	0.094	0.082	4.618	476	0.060	0.050	7xufA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0CI01	0.0	718	402	0.943	0.943	SPDE6_HUMAN Speedy protein E6 OS=Homo sapiens OX=9606 GN=SPDYE6 PE=1 SV=2
2	Q495Y8	0.0	718	402	0.945	0.945	SPDE2_HUMAN Speedy protein E2 OS=Homo sapiens OX=9606 GN=SPDYE2 PE=1 SV=2
3	P0DTA3	1.28e-114	337	265	0.458	0.694	SPD11_HUMAN Putative speedy protein E11 OS=Homo sapiens OX=9606 GN=SPDYE11 PE=5 SV=1
4	A6NLX3	1.78e-66	213	237	0.301	0.511	SPDE4_HUMAN Speedy protein E4 OS=Homo sapiens OX=9606 GN=SPDYE4 PE=1 SV=2
5	Q5IBH6	5.91e-61	200	268	0.259	0.388	SPE4A_MOUSE Speedy protein E4A OS=Mus musculus OX=10090 GN=Spdye4a PE=1 SV=1
6	Q9PU13	1.92e-19	90.1	299	0.144	0.194	SPD1A_XENLA Speedy protein 1-A OS=Xenopus laevis OX=8355 GN=spdya-a PE=1 SV=2
7	Q9YGL1	3.81e-18	86.3	298	0.142	0.191	SPD1B_XENLA Speedy protein 1-B OS=Xenopus laevis OX=8355 GN=spdya-b PE=1 SV=1
8	Q5MJ68	9.48e-18	85.1	293	0.109	0.150	SPDYC_HUMAN Speedy protein C OS=Homo sapiens OX=9606 GN=SPDYC PE=1 SV=1
9	Q4R1K5	1.94e-13	72.8	311	0.102	0.132	Q4R1K5_PIG Rapid inducer of G2/M progression in oocytes OS=Sus scrofa OX=9823 GN=RINGO PE=2 SV=1
10	Q5IBH7	2.83e-13	72.4	310	0.127	0.165	SPDYA_MOUSE Speedy protein A OS=Mus musculus OX=10090 GN=Spdya PE=1 SV=2
11	A0A384MTT5	3.38e-13	72.0	313	0.100	0.128	A0A384MTT5_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 GN=SPDY1 PE=2 SV=1
12	Q5MJ70	3.38e-13	72.0	313	0.100	0.128	SPDYA_HUMAN Speedy protein A OS=Homo sapiens OX=9606 GN=SPDYA PE=1 SV=2
13	A0A1D8PRQ6	4.5	32.3	1468	0.030	0.008	A0A1D8PRQ6_CANAL Lrg1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=LRG1 PE=4 SV=1
14	Q9FNQ1	4.9	32.0	2157	0.065	0.012	DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana OX=3702 GN=BRR2C PE=2 SV=1
15	O88944	7.4	31.6	873	0.055	0.025	KCNQ3_RAT Potassium voltage-gated channel subfamily KQT member 3 OS=Rattus norvegicus OX=10116 GN=Kcnq3 PE=1 SV=2
16	Q8K3F6	7.5	31.2	873	0.055	0.025	KCNQ3_MOUSE Potassium voltage-gated channel subfamily KQT member 3 OS=Mus musculus OX=10090 GN=Kcnq3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11357 Spy1	2.3e-53	191.4	Cell cycle regulatory protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000485398

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000266970	0.800	Cyclin-dependent kinase 2
2	9606.ENSP00000378699	0.800	Cyclin-dependent kinase 1
3	9606.ENSP00000326324	0.666	Leucine-rich repeat-containing protein 37A
4	9606.ENSP00000464535	0.656	Leucine-rich repeat-containing protein 37A3
5	9606.ENSP00000479693	0.618	Neuroblastoma breakpoint family member 14
6	9606.ENSP00000479362	0.614	Golgin subfamily A member 6-like protein 10
7	9606.ENSP00000321656	0.600	M-phase inducer phosphatase 3
8	9606.ENSP00000478609	0.561	Neuroblastoma breakpoint family member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019899	0.406	enzyme binding
GO:0019901	0.395	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0048518	0.979	positive regulation of biological process
GO:0051726	0.979	regulation of cell cycle
GO:0048522	0.968	positive regulation of cellular process
GO:0051246	0.963	regulation of protein metabolic process
GO:0031323	0.954	regulation of cellular metabolic process
GO:0009987	0.870	cellular process
GO:0045859	0.842	regulation of protein kinase activity
GO:0009893	0.839	positive regulation of metabolic process
GO:0031325	0.827	positive regulation of cellular metabolic process
GO:1904029	0.821	regulation of cyclin-dependent protein kinase activity
GO:0045787	0.695	positive regulation of cell cycle
GO:0022414	0.608	reproductive process
GO:0022402	0.583	cell cycle process
GO:0071704	0.521	organic substance metabolic process
GO:0043170	0.470	macromolecule metabolic process
GO:0044238	0.463	primary metabolic process
GO:0044237	0.453	cellular metabolic process
GO:0071900	0.446	regulation of protein serine/threonine kinase activity
GO:0006807	0.445	nitrogen compound metabolic process
GO:0090304	0.429	nucleic acid metabolic process
GO:0000079	0.398	regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0051173	0.360	positive regulation of nitrogen compound metabolic process
GO:0010564	0.352	regulation of cell cycle process
GO:0010604	0.342	positive regulation of macromolecule metabolic process
GO:0050896	0.339	response to stimulus
GO:0045737	0.327	positive regulation of cyclin-dependent protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.998	nuclear lumen
GO:0005654	0.991	nucleoplasm
GO:0005829	0.940	cytosol
GO:0043232	0.937	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]