StarFunc result for job id A0A590UJ96

User Input

>input (1178 residues)
MSRETRRGALPRLRRGEQAAKMPGRCVGPSRSGRGVRRPWGKRRGAGTSRGRGARRRAKP
SEWETRCVSAERPQGRQRPWGTRQAAETADAAGANEALGAPGTPGSIEAARDPGAVWVNG
AVGEPEVVGLAGAVWVTGSGEEETEDRSPRGCERKGRPGSLGHESILHLWLKVQAMRAAS
GCGEGSRVELHPVPAGEGPVERGVPGRASWVETSRGGLTGPWVKEQARGIPRAPSGPTAL
GLGAAYERALGFCGQGQAGRVPPASVPGALASSSEMAPHLWRGEAVGVPETGEEIGYGFV
SGPCEKEQTMGEPGTVGWTGAVGAPRAMEGELGCGGAAGLWGRGQSPQIPGALTHEAVCG
ATPGVWGRGQAVGVSDAVEEEPTSVGAAGVCYRRQAVEETDSVGMPGPWGTGYSVGVPCA
AEEETRCGGDPGFRERGQPVWVETGSGGDPGSRGAAQTAESSCPGEQAAGSGGAPGLWGI
QQATGVPRALGKDTGCVSVPGLWGAGQMVRVPQAVVVPGALGEELSHSGGLGLWDGQQAL
GGPPAEAVPGLGEETCSGNVLSPWERRQAVGEPESLGPPALGVPGSVDQEAGCGDVACQC
GRRQAVGVSETVGIPRAADVPRQGCAAAGVLMAMGVPGSGKVPARVPAAVWASGPVCQEG
SSRDILNLWERTRAARISVASGGPVAREELWSGGEESVASGGPVAQEELWSGGEESVASG
GHVAREKLWSGGEDCGSGAFPGPWGRRQTIGVPVVPEGPGLGGETDSGGIPRPWGQRQRV
RAPVATEVLLAPRVPGSVELEPGDGGFSGLSGRQQTAGMPGTVGLSAASGVPVAPRVPRP
VQEETGSELWGERETVGGPADAKGPTRMEVPTSTRMPGPMAEKTGSGGVSGLLGGRQTTG
VSMAVGLLGSVGEGTIFEHVSGLSGRRQTAGRPVAARGSMAVGVPTAPGLPGPMVGDTGS
GDDGSGIWGRRLATEGPTAARVPGPVEGETGSEGVSGLWRRRHGGAIPEAGRVPLPLGVL
AAVGAPMAGRAPAAVWVTGSSGAEADVGVSGLTVLRRQSTGGVGASEDETGGGNILGLAG
GSQAVGTSHTCVPGARLWSCPRSLGEETAYENALGMSGTRTAVGVPSVSREEIGLGHFRD
HLQPSGRRLAGGVSAVRVRGSNLGESYVGEARLRGAFQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BKS2	0.040	0.045	5.928E-2	939	0.126	0.158	Q8BKS2.pdb.gz	Q8BKS2_MOUSE Ahnak protein (Fragment) OS=Mus musculus OX=10090 GN=Ahnak PE=2 SV=2
2	AFDB:P25940	0.044	0.032	1.076E-1	1745	0.235	0.159	P25940.pdb.gz	CO5A3_HUMAN Collagen alpha-3(V) chain OS=Homo sapiens OX=9606 GN=COL5A3 PE=1 SV=3
3	AFDB:Q6DRQ0	0.039	0.046	1.229E-1	925	0.108	0.137	Q6DRQ0.pdb.gz
4	AFDB:Q9NRM1	0.032	0.032	1.313E-1	1142	0.149	0.153	Q9NRM1.pdb.gz	ENAM_HUMAN Enamelin OS=Homo sapiens OX=9606 GN=ENAM PE=1 SV=3
5	AFDB:Q9JLU4	0.042	0.031	2.383E-1	1740	0.179	0.121	Q9JLU4.pdb.gz	SHAN3_RAT SH3 and multiple ankyrin repeat domains protein 3 OS=Rattus norvegicus OX=10116 GN=Shank3 PE=1 SV=3
6	AFDB:F1QYN1	0.038	0.029	3.106E-1	1714	0.240	0.165	F1QYN1.pdb.gz
7	AFDB:Q9Y2K5	0.041	0.048	3.106E-1	976	0.125	0.151	Q9Y2K5.pdb.gz	R3HD2_HUMAN R3H domain-containing protein 2 OS=Homo sapiens OX=9606 GN=R3HDM2 PE=1 SV=3
8	AFDB:Q6W4X9	0.035	0.019	3.319E-1	2439	0.143	0.069	Q6W4X9.pdb.gz	MUC6_HUMAN Mucin-6 OS=Homo sapiens OX=9606 GN=MUC6 PE=1 SV=3
9	AFDB:F1LRJ1	0.036	0.028	3.789E-1	1671	0.246	0.174	F1LRJ1.pdb.gz	F1LRJ1_RAT Collagen type IV alpha 3 chain OS=Rattus norvegicus OX=10116 GN=Col4a3 PE=4 SV=2
10	AFDB:Q15648	0.036	0.029	3.789E-1	1581	0.149	0.111	Q15648.pdb.gz	MED1_HUMAN Mediator of RNA polymerase II transcription subunit 1 OS=Homo sapiens OX=9606 GN=MED1 PE=1 SV=4
11	PDB:7w59R	0.027	0.095	4.139	280	0.021	0.089	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
12	PDB:6z1fI	0.031	0.214	5.764	108	0.007	0.074	6z1fI.pdb.gz	Dual Functions of a Rubisco Activase in Metabolic Repair and Recruitment to Carboxysomes.
13	PDB:2xbpA	0.027	0.137	7.513	113	0.005	0.053	2xbpA.pdb.gz	A Novel Signal Transduction Protein P(II) Variant from Synechococcus Elongatus Pcc 7942 Indicates a Two-Step Process for Nagk- P(II) Complex Formation.
14	PDB:5mrcB	0.022	0.072	7.513	321	0.003	0.012	5mrcB.pdb.gz	The structure of the yeast mitochondrial ribosome.
15	PDB:2lxxA	0.026	0.151	8.028	152	0.007	0.053	2lxxA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6U1J6	0.10	39.3	2073	0.036	0.020	Q6U1J6_MUSPF Smooth muscle archvillin OS=Mustela putorius furo OX=9669 PE=1 SV=1
2	O46385	0.30	37.7	2194	0.036	0.019	SVIL_BOVIN Supervillin OS=Bos taurus OX=9913 GN=SVIL PE=1 SV=2
3	A0A6I8PIX7	0.41	37.4	1904	0.037	0.023	A0A6I8PIX7_HUMAN Supervillin OS=Homo sapiens OX=9606 GN=SVIL PE=1 SV=1
4	O95425	0.43	37.4	2214	0.037	0.019	SVIL_HUMAN Supervillin OS=Homo sapiens OX=9606 GN=SVIL PE=1 SV=2
5	Q9XD84	0.81	36.2	989	0.020	0.024	TIBA_ECOH1 Autotransporter adhesin/invasin TibA OS=Escherichia coli O78:H11 (strain H10407 / ETEC) OX=316401 GN=tibA PE=1 SV=1
6	Q8K480	3.7	34.3	584	0.035	0.070	MFRP_MOUSE Membrane frizzled-related protein OS=Mus musculus OX=10090 GN=Mfrp PE=1 SV=1
7	Q4W944	4.3	34.3	1775	0.028	0.019	ENCA_ASPFU Atrochrysone carboxylic acid synthase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=encA PE=1 SV=1
8	Q9LF98	8.0	32.7	358	0.021	0.070	ALFC8_ARATH Fructose-bisphosphate aldolase 8, cytosolic OS=Arabidopsis thaliana OX=3702 GN=FBA8 PE=1 SV=1
9	Q580S9	8.8	32.7	521	0.020	0.044	Q580S9_TRYB2 RanBP2-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.5L5.670 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 27679.XP_010340431.1

Rank	PPI partner	STRING score	Description
1	27679.XP_003921263.1	0.800	Collagen alpha-2(I) chain
2	27679.XP_003925919.1	0.800	Belongs to the integrin alpha chain family.
3	27679.XP_003931313.1	0.800	Collagen alpha-1(I) chain isoform X1
4	27679.XP_003940885.1	0.800	Collagen alpha-1(III) chain
5	27679.XP_010329951.1	0.800	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 1 base in 1 codon
6	27679.XP_010347350.1	0.800	Belongs to the integrin beta chain family.
7	27679.XP_003921858.1	0.600	Belongs to the integrin alpha chain family.
8	27679.XP_003921917.1	0.600	Belongs to the integrin alpha chain family.
9	27679.XP_003921990.1	0.600	Belongs to the integrin beta chain family.
10	27679.XP_003929738.1	0.600	Belongs to the integrin alpha chain family.
11	27679.XP_003930682.1	0.600	Belongs to the integrin alpha chain family.
12	27679.XP_003931047.1	0.600	Belongs to the integrin alpha chain family.
13	27679.XP_003934780.1	0.600	Belongs to the integrin beta chain family.
14	27679.XP_003936565.1	0.600	Cell surface proteoglycan
15	27679.XP_003939272.1	0.600	Belongs to the integrin beta chain family.
16	27679.XP_003939320.1	0.600	Belongs to the integrin alpha chain family.
17	27679.XP_003943669.2	0.600	Belongs to the integrin alpha chain family.
18	27679.XP_003944257.1	0.600	Belongs to the integrin alpha chain family.
19	27679.XP_010328277.1	0.600	Belongs to the protein kinase superfamily. Tyr protein kinase family
20	27679.XP_010328579.1	0.600	Belongs to the integrin beta chain family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.515	biological regulation
GO:0009987	0.349	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005737	0.985	cytoplasm
GO:0016020	0.959	membrane
GO:0043226	0.943	organelle
GO:0043227	0.873	membrane-bounded organelle
GO:0043229	0.858	intracellular organelle
GO:0043231	0.828	intracellular membrane-bounded organelle
GO:0071944	0.825	cell periphery
GO:0005886	0.818	plasma membrane
GO:0005576	0.788	extracellular region
GO:0032991	0.446	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]