StarFunc result for job id A0A5F9ZHI8

User Input

>input (444 residues)
MADSVLNHSWPAFSKLWLKRWAFKRGSEPKSCVQPFDSGAVASATKSSSGSWKPENPDFF
SAMGDDQEDDFPRRLSESMEDLSLDLGALQGSEYLQDLGLGAPSHSQPGETPDSRPTGEE
PGRDSLFSSLAGSQDLSRRRSWERSRSCSESWRRLSLDASAVDEEPCLPRTLASLALNLP
GGGLKTWTQGCLSGGGTPAESPGKECDSPKKRGRSRSVPVSFYEIRSPEISPGLEVPTPP
VQGLEPPVLECMEKDHVEPDHVLIVQQVLQELRQYHGARQRACMSASPGGAHSNLTWFEF
LSESEDGAGKNEKSDKSTSVKRRLSCLRSRVTRQKEKGKSPAHLKDKGQDARERRECVNG
HQLLQGTFSGPSSCPLCGKPFLSSGKSGGPIHPPGGQPLSLLHVLSIILLGSLLMCASSF
CFALSSAAPWREPGISPWAQGPLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q071D5	0.107	0.071	1.538E-2	750	0.153	0.091	Q071D5.pdb.gz
2	AFDB:Q7Z4V5	0.084	0.060	3.411E-2	671	0.144	0.095	Q7Z4V5.pdb.gz	HDGR2_HUMAN Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1
3	AFDB:Q3UMU9	0.075	0.052	8.085E-2	669	0.153	0.102	Q3UMU9.pdb.gz	HDGR2_MOUSE Hepatoma-derived growth factor-related protein 2 OS=Mus musculus OX=10090 GN=Hdgfl2 PE=1 SV=1
4	AFDB:Q99501	0.078	0.053	1.054E-1	681	0.176	0.115	Q99501.pdb.gz	GA2L1_HUMAN GAS2-like protein 1 OS=Homo sapiens OX=9606 GN=GAS2L1 PE=1 SV=2
5	AFDB:Q20435	0.065	0.055	1.127E-1	589	0.149	0.112	Q20435.pdb.gz	ATF6H_CAEEL Transcription factor atf-6 homolog OS=Caenorhabditis elegans OX=6239 GN=atf-6 PE=1 SV=2
6	AFDB:Q7TT79	0.059	0.035	1.127E-1	822	0.167	0.090	Q7TT79.pdb.gz	MCPH1_MOUSE Microcephalin OS=Mus musculus OX=10090 GN=Mcph1 PE=1 SV=1
7	AFDB:Q12215	0.081	0.069	1.469E-1	556	0.122	0.097	Q12215.pdb.gz	WSC3_YEAST Cell wall integrity and stress response component 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=WSC3 PE=1 SV=1
8	AFDB:Q8IZD4	0.069	0.053	1.469E-1	617	0.164	0.118	Q8IZD4.pdb.gz	DCP1B_HUMAN mRNA-decapping enzyme 1B OS=Homo sapiens OX=9606 GN=DCP1B PE=1 SV=2
9	AFDB:Q8IYW5	0.088	0.071	2.189E-1	571	0.122	0.095	Q8IYW5.pdb.gz	RN168_HUMAN E3 ubiquitin-protein ligase RNF168 OS=Homo sapiens OX=9606 GN=RNF168 PE=1 SV=1
10	PDB:3haxC	0.052	0.370	2.205E-1	53	0.029	0.245	3haxC.pdb.gz	Structural mechanism of substrate RNA recruitment in H/ACA RNA-guided pseudouridine synthase.
11	AFDB:Q8I7M7	0.076	0.057	3.483E-1	639	0.122	0.085	Q8I7M7.pdb.gz	Q8I7M7_CAEEL Tropomodulin OS=Caenorhabditis elegans OX=6239 GN=tmd-2 PE=1 SV=3
12	PDB:7p5xAJ	0.059	0.210	1.324	89	0.034	0.169	7p5xAJ.pdb.gz	Transcriptional control of mycobacterial DNA damage response by sigma adaptation.
13	PDB:6edtJ	0.083	0.181	1.615	109	0.047	0.193	6edtJ.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
14	PDB:2aqcA	0.064	0.317	4.673	63	0.018	0.127	2aqcA.pdb.gz	The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs.
15	PDB:7aocL	0.065	0.458	4.994	45	0.011	0.111	7aocL.pdb.gz	Conserved strategies of RNA polymerase I hibernation and activation.
16	PDB:2y0sP	0.065	0.468	5.703	45	0.018	0.178	2y0sP.pdb.gz	Archaeal RNA polymerase: the influence of the protruding stalk in crystal packing and preliminary biophysical analysis of the Rpo13 subunit.
17	PDB:5iv5BF	0.048	0.099	6.094	193	0.011	0.026	5iv5BF.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
18	PDB:1q14A	0.059	0.089	6.960	289	0.014	0.021	1q14A.pdb.gz	Structure and autoregulation of the Yeast Hst2 homolog of Sir2
19	PDB:7oikA	0.084	0.009	6.960	4426	0.029	0.003	7oikA.pdb.gz	E3 ubiquitin ligase RNF213 employs a non-canonical zinc finger active site and is allosterically regulated by ATP
20	PDB:3fkiL	0.073	0.334	7.438	47	0.011	0.106	3fkiL.pdb.gz	Structure of the 12-Subunit RNA Polymerase II Refined with the Aid of Anomalous Diffraction Data

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6ZSZ5	0.0	660	1361	0.725	0.237	ARHGI_HUMAN Rho guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=1 SV=4
2	A0A590UK10	1.23e-35	142	1089	0.151	0.062	A0A590UK10_HUMAN Rho guanine nucleotide exchange factor 18 (Fragment) OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=4 SV=1
3	Q8N1W1	0.021	40.0	1705	0.054	0.014	ARG28_HUMAN Rho guanine nucleotide exchange factor 28 OS=Homo sapiens OX=9606 GN=ARHGEF28 PE=1 SV=3
4	P97433	0.064	38.5	1700	0.054	0.014	ARG28_MOUSE Rho guanine nucleotide exchange factor 28 OS=Mus musculus OX=10090 GN=Arhgef28 PE=1 SV=2
5	Q99459	1.5	33.9	802	0.045	0.025	CDC5L_HUMAN Cell division cycle 5-like protein OS=Homo sapiens OX=9606 GN=CDC5L PE=1 SV=2
6	Q8BPM6	2.5	32.7	367	0.063	0.076	RIC3_MOUSE Protein RIC-3 OS=Mus musculus OX=10090 GN=Ric3 PE=1 SV=2
7	Q9C093	3.2	32.7	1822	0.063	0.015	SPEF2_HUMAN Sperm flagellar protein 2 OS=Homo sapiens OX=9606 GN=SPEF2 PE=1 SV=2
8	B0B1T9	3.6	32.3	367	0.065	0.079	B0B1T9_RAT RIC3 acetylcholine receptor chaperone OS=Rattus norvegicus OX=10116 GN=Ric3 PE=3 SV=1
9	Q499E4	3.9	32.3	774	0.043	0.025	DZI1L_MOUSE Cilium assembly protein DZIP1L OS=Mus musculus OX=10090 GN=Dzip1l PE=1 SV=1
10	O08837	5.3	32.0	802	0.043	0.024	CDC5L_RAT Cell division cycle 5-like protein OS=Rattus norvegicus OX=10116 GN=Cdc5l PE=1 SV=2
11	C8V9N8	7.0	31.6	833	0.045	0.024	C8V9N8_EMENI cysteine--tRNA ligase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_08800 PE=3 SV=1
12	F6P6M2	8.5	31.6	1753	0.032	0.008	F6P6M2_DANRE Rho guanine nucleotide exchange factor (GEF) 28a OS=Danio rerio OX=7955 GN=arhgef28 PE=4 SV=1
13	D4ADT7	9.2	31.2	953	0.063	0.029	D4ADT7_RAT Nucleotide-binding oligomerization domain containing 1 OS=Rattus norvegicus OX=10116 GN=Nod1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008960640.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008960639.1	0.628	Rho guanine nucleotide exchange factor 18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.995	protein binding
GO:0098772	0.743	molecular function regulator activity
GO:0005085	0.354	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0048523	0.983	negative regulation of cellular process
GO:0009987	0.968	cellular process
GO:0050896	0.963	response to stimulus
GO:0051716	0.904	cellular response to stimulus
GO:0007165	0.886	signal transduction
GO:0048583	0.865	regulation of response to stimulus
GO:0023051	0.858	regulation of signaling
GO:0010646	0.855	regulation of cell communication
GO:0048518	0.770	positive regulation of biological process
GO:0009966	0.768	regulation of signal transduction
GO:0051128	0.756	regulation of cellular component organization
GO:0050793	0.755	regulation of developmental process
GO:0048522	0.753	positive regulation of cellular process
GO:0022603	0.625	regulation of anatomical structure morphogenesis
GO:0016043	0.624	cellular component organization
GO:0006996	0.600	organelle organization
GO:0035556	0.588	intracellular signal transduction
GO:1902531	0.547	regulation of intracellular signal transduction
GO:0051129	0.540	negative regulation of cellular component organization
GO:0044087	0.536	regulation of cellular component biogenesis
GO:0051497	0.487	negative regulation of stress fiber assembly
GO:0008360	0.485	regulation of cell shape
GO:0007264	0.485	small GTPase mediated signal transduction
GO:0030036	0.484	actin cytoskeleton organization
GO:0042981	0.343	regulation of apoptotic process
GO:0065009	0.339	regulation of molecular function
GO:0065008	0.339	regulation of biological quality
GO:0071310	0.339	cellular response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.997	membrane-bounded organelle
GO:0005737	0.997	cytoplasm
GO:0043229	0.970	intracellular organelle
GO:0005829	0.970	cytosol
GO:0005576	0.761	extracellular region
GO:0043231	0.699	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]