StarFunc result for job id A0A5K1VDZ0

User Input

>input (331 residues)
MSLLVVSMACVGFFLLQGAWPHEGVHRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLL
HREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDI
VIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGTKVNGT
FQANFPLGPATHGGTYRCFGSFRDSPYEWSKSSDPLLVSVTGNPRHLHILIGTSVVIILF
ILLFFLLHCWCSNKKNAAVMDQESAGNRTANSEDSDEQDPQEVTYTQLNHCVFTQRKITR
PSQRPKTPPTDIIVYTELPNAESRSKVVSCP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P43626	0.632	0.602	1.346E-56	348	0.985	0.937	P43626.pdb.gz	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
2	AFDB:Q14952	0.600	0.652	1.676E-47	304	0.758	0.826	Q14952.pdb.gz	KI2S3_HUMAN Killer cell immunoglobulin-like receptor 2DS3 OS=Homo sapiens OX=9606 GN=KIR2DS3 PE=2 SV=1
3	AFDB:P43632	0.608	0.662	1.170E-46	304	0.755	0.822	P43632.pdb.gz	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2
4	AFDB:P43629	0.623	0.469	9.096E-46	444	0.795	0.592	P43629.pdb.gz	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
5	AFDB:P43630	0.594	0.434	2.277E-45	455	0.837	0.609	P43630.pdb.gz	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
6	AFDB:Q8N743	0.707	0.576	3.151E-42	410	0.698	0.563	Q8N743.pdb.gz	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
7	AFDB:Q99706	0.540	0.477	1.653E-36	377	0.613	0.538	Q99706.pdb.gz	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3
8	AFDB:O75022	0.555	0.301	9.666E-28	631	0.347	0.182	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
9	AFDB:Q8NHL6	0.550	0.288	4.151E-27	650	0.360	0.183	Q8NHL6.pdb.gz	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
10	AFDB:Q8N423	0.548	0.311	6.393E-27	598	0.323	0.179	Q8N423.pdb.gz	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
11	PDB:5c6wJ	0.236	0.301	3.358E-8	238	0.079	0.109	5c6wJ.pdb.gz
12	PDB:1cf8L	0.261	0.371	5.366E-6	215	0.079	0.121	1cf8L.pdb.gz	Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions
13	PDB:1ehlL	0.241	0.332	5.977E-6	217	0.079	0.120	1ehlL.pdb.gz	Crystal structure of the 64M-2 antibody Fab fragment in complex with a DNA dT(6-4)T photoproduct formed by ultraviolet radiation.
14	PDB:6vxkB	0.202	0.117	6.309E-6	747	0.076	0.033	6vxkB.pdb.gz
15	PDB:3bn9F	0.281	0.364	7.829E-6	224	0.094	0.138	3bn9F.pdb.gz
16	PDB:1ngwH	0.273	0.367	8.721E-6	216	0.094	0.144	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
17	PDB:1ahwA	0.222	0.321	9.205E-6	214	0.082	0.126	1ahwA.pdb.gz
18	PDB:6enyC	0.216	0.201	1.025E-5	364	0.109	0.099	6enyC.pdb.gz	Structure of the human MHC-I peptide-loading complex.
19	PDB:1a8jL	0.241	0.348	1.142E-5	216	0.066	0.102	1a8jL.pdb.gz	Treatment of osteoarthritis with aspartame.
20	PDB:1knoE	0.256	0.365	1.418E-5	214	0.088	0.136	1knoE.pdb.gz	Crystal structure of the complex of a catalytic antibody Fab fragment with a transition state analog: structural similarities in esterase-like catalytic antibodies.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P43626	0.0	665	348	0.985	0.937	KI2L1_HUMAN Killer cell immunoglobulin-like receptor 2DL1 OS=Homo sapiens OX=9606 GN=KIR2DL1 PE=1 SV=1
2	P43627	0.0	610	348	0.943	0.897	KI2L2_HUMAN Killer cell immunoglobulin-like receptor 2DL2 OS=Homo sapiens OX=9606 GN=KIR2DL2 PE=1 SV=1
3	P43628	0.0	575	341	0.879	0.853	KI2L3_HUMAN Killer cell immunoglobulin-like receptor 2DL3 OS=Homo sapiens OX=9606 GN=KIR2DL3 PE=1 SV=1
4	P43631	0.0	523	304	0.782	0.852	KI2S2_HUMAN Killer cell immunoglobulin-like receptor 2DS2 OS=Homo sapiens OX=9606 GN=KIR2DS2 PE=1 SV=2
5	P43632	0.0	505	304	0.755	0.822	KI2S4_HUMAN Killer cell immunoglobulin-like receptor 2DS4 OS=Homo sapiens OX=9606 GN=KIR2DS4 PE=1 SV=2
6	Q14952	0.0	505	304	0.758	0.826	KI2S3_HUMAN Killer cell immunoglobulin-like receptor 2DS3 OS=Homo sapiens OX=9606 GN=KIR2DS3 PE=2 SV=1
7	Q14953	0.0	514	304	0.770	0.839	KI2S5_HUMAN Killer cell immunoglobulin-like receptor 2DS5 OS=Homo sapiens OX=9606 GN=KIR2DS5 PE=1 SV=2
8	Q14954	0.0	554	304	0.825	0.898	KI2S1_HUMAN Killer cell immunoglobulin-like receptor 2DS1 OS=Homo sapiens OX=9606 GN=KIR2DS1 PE=1 SV=2
9	P43629	2.57e-179	505	444	0.801	0.597	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
10	P43630	6.82e-170	481	455	0.761	0.554	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
11	Q8N743	8.90e-167	472	410	0.698	0.563	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
12	F2VZG2	2.51e-158	446	293	0.692	0.782	F2VZG2_PANTR KIR2DS4 OS=Pan troglodytes OX=9598 GN=KIR2DS4 PE=1 SV=1
13	Q14943	1.08e-131	382	382	0.604	0.524	KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 OS=Homo sapiens OX=9606 GN=KIR3DS1 PE=1 SV=2
14	Q99706	1.34e-129	376	377	0.613	0.538	KI2L4_HUMAN Killer cell immunoglobulin-like receptor 2DL4 OS=Homo sapiens OX=9606 GN=KIR2DL4 PE=1 SV=3
15	Q8NHL6	4.59e-44	162	650	0.278	0.142	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
16	O75022	1.69e-42	157	631	0.284	0.149	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
17	P59901	1.31e-40	150	499	0.269	0.178	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
18	O75019	1.06e-39	147	489	0.260	0.176	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
19	Q8N149	1.67e-39	147	483	0.260	0.178	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
20	Q8N423	2.40e-39	148	597	0.260	0.144	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06129 Chordopox_G3	1.8e+02	14.2	Chordopoxvirus G3 protein
2	PF00047 ig	5.1e-18	76.4	Immunoglobulin domain
3	PF13895 Ig_2	3.1e-05	35.5	Immunoglobulin domain
4	PF13927 Ig_3	2.1e-05	36.3	Immunoglobulin domain
5	PF15330 SIT	3.4e+02	13.1	SHP2-interacting transmembrane adaptor protein, SIT
6	PF07686 V-set	35	16.0	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000336769

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365402	0.999	HLA class I histocompatibility antigen, Cw-7 alpha chain
2	9606.ENSP00000371333	0.972	Natural killer cells antigen CD94
3	9606.ENSP00000438038	0.972	NKG2-A/NKG2-B type II integral membrane protein
4	9606.ENSP00000452780	0.971	Beta-2-microglobulin
5	9606.ENSP00000371327	0.960	NKG2-C type II integral membrane protein
6	9606.ENSP00000340944	0.943	Tyrosine-protein phosphatase non-receptor type 11
7	9606.ENSP00000379873	0.940	HLA class I histocompatibility antigen, A-3 alpha chain
8	9606.ENSP00000399168	0.918	HLA class I histocompatibility antigen, B-7 alpha chain
9	9606.ENSP00000365817	0.916	HLA class I histocompatibility antigen, alpha chain E
10	9606.ENSP00000342215	0.904	Killer cell immunoglobulin-like receptor 2DL3
11	9606.ENSP00000375608	0.864	Killer cell immunoglobulin-like receptor 3DL1
12	9606.ENSP00000391592	0.862	Tyrosine-protein phosphatase non-receptor type 6
13	9606.ENSP00000325525	0.861	Killer cell immunoglobulin-like receptor 3DL2
14	9606.ENSP00000240618	0.860	Killer cell lectin-like receptor subfamily K, member 1
15	9606.ENSP00000310216	0.859	NKG2-F type II integral membrane protein
16	9606.ENSP00000437563	0.858	Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells
17	9606.ENSP00000412927	0.839	HLA class I histocompatibility antigen, alpha chain G
18	9606.ENSP00000480609	0.829	annotation not available
19	9606.ENSP00000342156	0.814	Natural cytotoxicity triggering receptor 3
20	9606.ENSP00000291860	0.810	Killer cell immunoglobulin-like receptor 3DL3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.939	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0009987	0.987	cellular process
GO:0002376	0.987	immune system process
GO:0050794	0.986	regulation of cellular process
GO:0002682	0.955	regulation of immune system process
GO:0007154	0.919	cell communication
GO:0051716	0.917	cellular response to stimulus
GO:0006955	0.916	immune response
GO:0023052	0.915	signaling
GO:0007165	0.914	signal transduction
GO:0007166	0.889	cell surface receptor signaling pathway
GO:0048583	0.814	regulation of response to stimulus
GO:0006950	0.688	response to stress
GO:0050776	0.678	regulation of immune response
GO:0048518	0.647	positive regulation of biological process
GO:0006952	0.633	defense response
GO:0002764	0.459	immune response-regulating signaling pathway
GO:0002684	0.407	positive regulation of immune system process
GO:0048584	0.398	positive regulation of response to stimulus
GO:0050778	0.380	positive regulation of immune response
GO:0048519	0.378	negative regulation of biological process
GO:0032501	0.376	multicellular organismal process
GO:0048523	0.361	negative regulation of cellular process
GO:0048522	0.354	positive regulation of cellular process
GO:0051239	0.319	regulation of multicellular organismal process
GO:0002768	0.314	immune response-regulating cell surface receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]