StarFunc result for job id A0A5S8K742

User Input

>input (417 residues)
MTTLVPATLSFLLLWTLPGQVLLRVALAKEEVKSGTKGSQPMSPSDFLDKLMGRTSGYDA
RIRPNFKGPPVNVTCNIFINSFSSITKTTMDYRVNVFLRQQWNDPRLSYREYPDDSLDLD
PSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLILSCLMDLKNFP
MDIQTCTMQLESFGYTMKDLVFEWLEDAPAVQVAEGLTLPQFILRDEKDLGCCTKHYNTG
KFTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTT
QSSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAINFVSRQHKEFIRLRRRQRRQR
LEEDIIQESRFYFRGYGLGHCLQARDGGPMEGSGIYSPQPPAPLLREGETTRKLYVD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q61603	0.827	0.759	5.018E-73	456	0.918	0.840	Q61603.pdb.gz	GLRA4_MOUSE Glycine receptor subunit alpha-4 OS=Mus musculus OX=10090 GN=Glra4 PE=1 SV=3
2	AFDB:F1Q832	0.806	0.733	6.342E-67	459	0.784	0.712	F1Q832.pdb.gz
3	AFDB:P22771	0.799	0.739	1.154E-64	452	0.767	0.708	P22771.pdb.gz	GLRA2_RAT Glycine receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Glra2 PE=1 SV=1
4	AFDB:A0A2R8QMY9	0.785	0.713	2.497E-62	460	0.719	0.652	A0A2R8QMY9.pdb.gz
5	AFDB:O75311	0.793	0.714	2.645E-62	464	0.719	0.647	O75311.pdb.gz	GLRA3_HUMAN Glycine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=GLRA3 PE=1 SV=2
6	AFDB:B3DJL8	0.788	0.732	2.672E-61	450	0.710	0.658	B3DJL8.pdb.gz
7	AFDB:O93430	0.782	0.736	3.000E-61	444	0.710	0.667	O93430.pdb.gz	GLRA1_DANRE Glycine receptor subunit alphaZ1 OS=Danio rerio OX=7955 GN=glra1 PE=1 SV=1
8	AFDB:Q5U3C8	0.801	0.631	3.000E-61	532	0.710	0.556	Q5U3C8.pdb.gz	Q5U3C8_DANRE Glra4b protein (Fragment) OS=Danio rerio OX=7955 GN=glra4b PE=2 SV=1
9	AFDB:F1R8P4	0.823	0.765	4.496E-61	449	0.727	0.675	F1R8P4.pdb.gz	GLRA2_DANRE Glycine receptor subunit alpha-2 OS=Danio rerio OX=7955 GN=glra2 PE=3 SV=2
10	AFDB:P07727	0.767	0.700	7.566E-61	457	0.710	0.648	P07727.pdb.gz	GLRA1_RAT Glycine receptor subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Glra1 PE=1 SV=4
11	PDB:6i53B	0.687	0.844	2.755E-38	338	0.326	0.402	6i53B.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
12	PDB:6i53A	0.684	0.815	4.911E-38	349	0.302	0.361	6i53A.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
13	PDB:7kuyE	0.672	0.821	1.857E-37	338	0.408	0.503	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
14	PDB:4hfcA	0.601	0.795	1.285E-22	311	0.137	0.183	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
15	PDB:7l6qA	0.534	0.701	2.808E-19	311	0.170	0.228	7l6qA.pdb.gz	Structure and function at the lipid-protein interface of a pentameric ligand-gated ion channel.
16	PDB:6zgdA	0.516	0.727	1.241E-14	288	0.137	0.198	6zgdA.pdb.gz
17	PDB:4afhA	0.364	0.665	1.117E-13	213	0.074	0.146	4afhA.pdb.gz	Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
18	PDB:2w8gC	0.393	0.711	5.636E-13	217	0.077	0.147	2w8gC.pdb.gz	Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
19	PDB:4aq5E	0.569	0.634	6.327E-13	370	0.165	0.186	4aq5E.pdb.gz
20	PDB:4wz9B	0.110	0.069	1.166E-3	887	0.048	0.023	4wz9B.pdb.gz	The Anopheles-midgut APN1 structure reveals a new malaria transmission-blocking vaccine epitope.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D1KZ66	0.0	633	448	0.724	0.674	D1KZ66_DANRE Glycine receptor alpha 2 subunit OS=Danio rerio OX=7955 GN=glra2 PE=2 SV=1
2	F1R8P4	0.0	635	449	0.727	0.675	GLRA2_DANRE Glycine receptor subunit alpha-2 OS=Danio rerio OX=7955 GN=glra2 PE=3 SV=2
3	F1RDZ6	0.0	691	457	0.811	0.740	F1RDZ6_DANRE Glycine receptor subunit alpha-4 isoform X1 OS=Danio rerio OX=7955 GN=[a]Z2 PE=3 SV=1
4	O75311	0.0	643	464	0.753	0.677	GLRA3_HUMAN Glycine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=GLRA3 PE=1 SV=2
5	O93430	0.0	628	444	0.719	0.676	GLRA1_DANRE Glycine receptor subunit alphaZ1 OS=Danio rerio OX=7955 GN=glra1 PE=1 SV=1
6	P07727	0.0	608	457	0.727	0.663	GLRA1_RAT Glycine receptor subunit alpha-1 OS=Rattus norvegicus OX=10116 GN=Glra1 PE=1 SV=4
7	P22771	0.0	651	452	0.782	0.721	GLRA2_RAT Glycine receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Glra2 PE=1 SV=1
8	P23415	0.0	619	457	0.736	0.672	GLRA1_HUMAN Glycine receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=GLRA1 PE=1 SV=2
9	P23416	0.0	656	452	0.777	0.717	GLRA2_HUMAN Glycine receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=GLRA2 PE=1 SV=1
10	P24524	0.0	639	464	0.748	0.672	GLRA3_RAT Glycine receptor subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Glra3 PE=1 SV=1
11	Q5U3C8	0.0	619	532	0.743	0.583	Q5U3C8_DANRE Glra4b protein (Fragment) OS=Danio rerio OX=7955 GN=glra4b PE=2 SV=1
12	Q61603	0.0	802	456	0.947	0.866	GLRA4_MOUSE Glycine receptor subunit alpha-4 OS=Mus musculus OX=10090 GN=Glra4 PE=1 SV=3
13	Q64018	0.0	609	457	0.727	0.663	GLRA1_MOUSE Glycine receptor subunit alpha-1 OS=Mus musculus OX=10090 GN=Glra1 PE=1 SV=2
14	Q7TNC8	0.0	653	452	0.784	0.723	GLRA2_MOUSE Glycine receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Glra2 PE=1 SV=1
15	Q90W14	0.0	609	450	0.724	0.671	Q90W14_DANRE Glycine receptor alphaZ3 subunit OS=Danio rerio OX=7955 GN=glyRalpha3 PE=2 SV=1
16	Q91XP5	0.0	642	464	0.753	0.677	GLRA3_MOUSE Glycine receptor subunit alpha-3 OS=Mus musculus OX=10090 GN=Glra3 PE=1 SV=2
17	Q9DES9	0.0	678	456	0.794	0.726	Q9DES9_DANRE Glycine receptor alphaZ2 subunit OS=Danio rerio OX=7955 GN=glyR alpha PE=2 SV=1
18	Q6DC22	2.19e-115	348	494	0.422	0.356	Q6DC22_DANRE Glycine receptor beta subunit 2 OS=Danio rerio OX=7955 GN=glrb2 PE=1 SV=1
19	P48168	3.76e-114	345	496	0.427	0.359	GLRB_MOUSE Glycine receptor subunit beta OS=Mus musculus OX=10090 GN=Glrb PE=1 SV=2
20	P20781	4.37e-114	344	496	0.427	0.359	GLRB_RAT Glycine receptor subunit beta OS=Rattus norvegicus OX=10116 GN=Glrb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02931 Neur_chan_LBD	8.4e-47	170.9	Neurotransmitter-gated ion-channel ligand binding domain
2	PF02932 Neur_chan_memb	1.2e-29	115.7	Neurotransmitter-gated ion-channel transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361700

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000411593	0.809	Glycine receptor subunit alpha-1
2	9606.ENSP00000373918	0.710	Glycine--tRNA ligase
3	9606.ENSP00000361711	0.681	Transcription elongation factor A protein-like 3
4	9606.ENSP00000399888	0.661	High mobility group protein HMG-I/HMG-Y
5	9606.ENSP00000361708	0.657	Transcription elongation factor A like family
6	9606.ENSP00000243298	0.648	Ras-related protein Rab-9B
7	9606.ENSP00000417901	0.636	Gephyrin
8	9606.ENSP00000434364	0.623	Sodium- and chloride-dependent glycine transporter 2
9	9606.ENSP00000361860	0.616	Transcription elongation factor A like family
10	9606.ENSP00000464976	0.512	Zinc finger protein 850
11	9606.ENSP00000308708	0.503	T-complex protein 11 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016933	1.000	extracellularly glycine-gated ion channel activity
GO:0015318	0.981	inorganic molecular entity transmembrane transporter activity
GO:0030594	0.973	neurotransmitter receptor activity
GO:1901702	0.966	salt transmembrane transporter activity
GO:0005254	0.958	chloride channel activity
GO:0005488	0.905	binding
GO:0005515	0.816	protein binding
GO:0022824	0.790	transmitter-gated monoatomic ion channel activity
GO:0099095	0.760	ligand-gated monoatomic anion channel activity
GO:0004888	0.602	transmembrane signaling receptor activity
GO:0008324	0.470	monoatomic cation transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.979	cellular process
GO:0050789	0.971	regulation of biological process
GO:0006820	0.966	monoatomic anion transport
GO:0050896	0.965	response to stimulus
GO:0015698	0.965	inorganic anion transport
GO:0050794	0.960	regulation of cellular process
GO:0006821	0.940	chloride transport
GO:0032501	0.929	multicellular organismal process
GO:0001101	0.927	response to acid chemical
GO:0050905	0.848	neuromuscular process
GO:0043200	0.808	response to amino acid
GO:1901214	0.802	regulation of neuron death
GO:0048856	0.757	anatomical structure development
GO:0055085	0.741	transmembrane transport
GO:0098660	0.669	inorganic ion transmembrane transport
GO:0048523	0.667	negative regulation of cellular process
GO:0045664	0.578	regulation of neuron differentiation
GO:0007275	0.531	multicellular organism development
GO:0034220	0.517	monoatomic ion transmembrane transport
GO:0009605	0.496	response to external stimulus
GO:0023052	0.432	signaling
GO:0007154	0.432	cell communication
GO:0051716	0.400	cellular response to stimulus
GO:0048731	0.393	system development
GO:0007399	0.343	nervous system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.993	organelle
GO:0030054	0.939	cell junction
GO:0045202	0.866	synapse
GO:0005622	0.793	intracellular anatomical structure
GO:0043227	0.756	membrane-bounded organelle
GO:0043231	0.718	intracellular membrane-bounded organelle
GO:0005737	0.669	cytoplasm
GO:0098590	0.495	plasma membrane region
GO:0097060	0.486	synaptic membrane
GO:0098690	0.462	glycinergic synapse
GO:0032991	0.394	protein-containing complex
GO:0098794	0.369	postsynapse
GO:0045211	0.347	postsynaptic membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	0.958	chloride(in) = chloride(out)

[back to server]