StarFunc result for job id A0A7I2V3R4

User Input

>input (345 residues)
MAAPASDSGGSQQSPSSSPGSREGAGVAAKGAPDCGDAGARDAAETVSGLPPLEDYECKI
CYNYFDADRRAPKLLACLHTFCQECLSQLQLRAAAAAAAAAAPERPPRPPPWLCPPGAIA
CPVCRHRTPLPDSRVHGLPNNTKLAEAFPLALRAAHDPLPQDRLPPLPARLPAPAAAPPP
TPAPPPPPSPAPPQPPPPPPAEDAAPGPRARPGLRAPGAYDSCQNCKRAALTAGCVCVVF
SFLSMVVLLFTGLIFVNHYGGGGTPGGGAPPGEAPATGSPSPSPVGPICLSVASILALFS
VVVTWVICWLKYRPEGAAAGSTGGSGGGGGPRARAAAGGARRSDT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N6D2	0.223	0.301	2.118E-8	247	0.162	0.227	Q8N6D2.pdb.gz	RN182_HUMAN E3 ubiquitin-protein ligase RNF182 OS=Homo sapiens OX=9606 GN=RNF182 PE=1 SV=1
2	AFDB:P32917	0.124	0.057	5.451E-2	917	0.116	0.044	P32917.pdb.gz	STE5_YEAST Protein STE5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STE5 PE=1 SV=2
3	AFDB:Q386X5	0.143	0.154	5.451E-2	318	0.125	0.135	Q386X5.pdb.gz	Q386X5_TRYB2 RING-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.39.0007 PE=4 SV=1
4	AFDB:A7TJH8	0.130	0.063	1.101E-1	848	0.099	0.040	A7TJH8.pdb.gz	A7TJH8_VANPO RING-type domain-containing protein (Fragment) OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294 / BCRC 21397 / CBS 2163 / NBRC 10782 / NRRL Y-8283 / UCD 57-17) OX=436907 GN=Kpol_1061p54 PE=1 SV=1
5	AFDB:P97868	0.202	0.046	1.615E-1	1790	0.125	0.024	P97868.pdb.gz	RBBP6_MOUSE E3 ubiquitin-protein ligase RBBP6 OS=Mus musculus OX=10090 GN=Rbbp6 PE=1 SV=5
6	PDB:8a3tU	0.149	0.396	1.799E-1	114	0.055	0.167	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
7	AFDB:P93744	0.146	0.123	1.956E-1	425	0.122	0.099	P93744.pdb.gz	P93744_ARATH E3 ubiquitin-protein ligase RMA OS=Arabidopsis thaliana OX=3702 GN=MUSE2 PE=1 SV=1
8	PDB:7od1A	0.155	0.127	2.179E-1	430	0.072	0.058	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
9	AFDB:O82239	0.167	0.162	2.223E-1	358	0.096	0.092	O82239.pdb.gz	RFI2_ARATH E3 ubiquitin-protein ligase RFI2 OS=Arabidopsis thaliana OX=3702 GN=RFI2 PE=1 SV=2
10	AFDB:Q5Z8R1	0.133	0.101	2.223E-1	455	0.139	0.105	Q5Z8R1.pdb.gz	IPI1_ORYSJ E3 ubiquitin-protein ligase IPI1 OS=Oryza sativa subsp. japonica OX=39947 GN=IPI1 PE=1 SV=1
11	PDB:3m62A	0.160	0.065	3.408E-1	955	0.035	0.013	3m62A.pdb.gz
12	AFDB:Q9P3U8	0.188	0.142	3.477E-1	468	0.067	0.049	Q9P3U8.pdb.gz	YJ95_SCHPO Uncharacterized RING finger protein C548.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC548.05c PE=4 SV=1
13	AFDB:Q80XJ2	0.174	0.111	3.951E-1	565	0.087	0.053	Q80XJ2.pdb.gz	RN168_MOUSE E3 ubiquitin-protein ligase RNF168 OS=Mus musculus OX=10090 GN=Rnf168 PE=1 SV=3
14	PDB:7z36B	0.156	0.122	1.390	446	0.058	0.045	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
15	PDB:4c2mI	0.053	0.130	1.580	124	0.038	0.105	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.
16	PDB:7e1vM	0.140	0.130	1.580	378	0.061	0.056	7e1vM.pdb.gz	Structure of Mycobacterium tuberculosis cytochrome bcc in complex with Q203 and TB47, two anti-TB drug candidates.
17	PDB:5n5yI	0.053	0.158	2.634	99	0.038	0.131	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
18	PDB:7lbmd	0.122	0.149	2.634	275	0.055	0.069	7lbmd.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
19	PDB:2lgvA	0.085	0.256	3.190	100	0.049	0.170	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
20	PDB:4a0cF	0.105	0.394	3.625	80	0.032	0.138	4a0cF.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N6D2	2.38e-10	62.4	247	0.145	0.202	RN182_HUMAN E3 ubiquitin-protein ligase RNF182 OS=Homo sapiens OX=9606 GN=RNF182 PE=1 SV=1
2	Q58EC8	8.20e-10	60.1	198	0.159	0.278	RN152_DANRE E3 ubiquitin-protein ligase rnf152 OS=Danio rerio OX=7955 GN=rnf152 PE=2 SV=1
3	F4HY36	1.05e-07	56.2	1805	0.084	0.016	F4HY36_ARATH Protein translocase subunit SecA OS=Arabidopsis thaliana OX=3702 GN=SECA2 PE=1 SV=1
4	Q9R1R2	2.17e-07	55.1	744	0.107	0.050	TRIM3_MOUSE Tripartite motif-containing protein 3 OS=Mus musculus OX=10090 GN=Trim3 PE=1 SV=1
5	O70277	4.15e-07	53.9	744	0.107	0.050	TRIM3_RAT Tripartite motif-containing protein 3 OS=Rattus norvegicus OX=10116 GN=Trim3 PE=1 SV=1
6	O75382	7.92e-06	50.1	744	0.101	0.047	TRIM3_HUMAN Tripartite motif-containing protein 3 OS=Homo sapiens OX=9606 GN=TRIM3 PE=1 SV=2
7	E7F1U3	6.05e-05	47.4	774	0.090	0.040	E7F1U3_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim3a PE=1 SV=1
8	Q9FY48	9.50e-05	47.0	1625	0.070	0.015	KEG_ARATH E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana OX=3702 GN=KEG PE=1 SV=2
9	Q8BG47	1.07e-04	45.1	203	0.055	0.094	RN152_MOUSE E3 ubiquitin-protein ligase RNF152 OS=Mus musculus OX=10090 GN=Rnf152 PE=1 SV=1
10	Q8N8N0	1.14e-04	45.1	203	0.055	0.094	RN152_HUMAN E3 ubiquitin-protein ligase RNF152 OS=Homo sapiens OX=9606 GN=RNF152 PE=1 SV=1
11	Q19818	1.42e-04	46.2	1032	0.125	0.042	Q19818_CAEEL RING-type E3 ubiquitin transferase OS=Caenorhabditis elegans OX=6239 GN=nhl-2 PE=1 SV=2
12	Q58ER5	2.16e-04	45.4	744	0.084	0.039	Q58ER5_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=zgc:113099 PE=2 SV=1
13	Q96D59	2.76e-04	43.5	192	0.087	0.156	RN183_HUMAN E3 ubiquitin-protein ligase RNF183 OS=Homo sapiens OX=9606 GN=RNF183 PE=1 SV=2
14	Q8QZS5	4.04e-04	43.1	190	0.087	0.158	RN183_MOUSE E3 ubiquitin-protein ligase RNF183 OS=Mus musculus OX=10090 GN=Rnf183 PE=1 SV=1
15	Q9BRZ2	4.17e-04	44.7	755	0.081	0.037	TRI56_HUMAN E3 ubiquitin-protein ligase TRIM56 OS=Homo sapiens OX=9606 GN=TRIM56 PE=1 SV=3
16	P36406	0.001	42.7	574	0.113	0.068	TRI23_HUMAN E3 ubiquitin-protein ligase TRIM23 OS=Homo sapiens OX=9606 GN=TRIM23 PE=1 SV=1
17	Q80VI1	0.001	42.7	734	0.075	0.035	TRI56_MOUSE E3 ubiquitin-protein ligase TRIM56 OS=Mus musculus OX=10090 GN=Trim56 PE=1 SV=1
18	P36407	0.002	42.7	573	0.113	0.068	TRI23_RAT E3 ubiquitin-protein ligase TRIM23 OS=Rattus norvegicus OX=10116 GN=Trim23 PE=2 SV=2
19	Q8BGX0	0.002	42.7	574	0.113	0.068	TRI23_MOUSE E3 ubiquitin-protein ligase TRIM23 OS=Mus musculus OX=10090 GN=Trim23 PE=2 SV=1
20	Q9H0X6	0.002	41.6	261	0.081	0.107	RN208_HUMAN RING finger protein 208 OS=Homo sapiens OX=9606 GN=RNF208 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14358 DUF4405	6.8e+02	12.1	Domain of unknown function (DUF4405)
2	PF00097 zf-C3HC4	0.18	23.0	Zinc finger, C3HC4 type (RING finger)
3	PF13923 zf-C3HC4_2	0.24	22.6	Zinc finger, C3HC4 type (RING finger)
4	PF15227 zf-C3HC4_4	0.48	21.9	zinc finger of C3HC4-type, RING
5	PF13639 zf-RING_2	0.0015	30.1	Ring finger domain
6	PF14634 zf-RING_5	0.00022	32.5	zinc-RING finger domain
7	PF13445 zf-RING_UBOX	2.4e-05	35.6	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9361.ENSDNOP00000022414

Rank	PPI partner	STRING score	Description
1	9361.ENSDNOP00000021613	0.644	Histone cluster 1, H3b
2	9361.ENSDNOP00000025631	0.644	annotation not available
3	9361.ENSDNOP00000022283	0.623	Plexin B2
4	9361.ENSDNOP00000033522	0.608	RAN binding protein 2
5	9361.ENSDNOP00000018827	0.599	Obscurin, cytoskeletal calmodulin and titin-interacting RhoGEF
6	9361.ENSDNOP00000031822	0.548	WD repeat domain 38
7	9361.ENSDNOP00000008771	0.511	Nucleoporin 155kDa
8	9361.ENSDNOP00000021633	0.508	Ubiquitin A-52 residue ribosomal protein fusion product 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004842	0.999	ubiquitin-protein transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:1901564	0.983	organonitrogen compound metabolic process
GO:0043170	0.951	macromolecule metabolic process
GO:0019538	0.939	protein metabolic process
GO:0043412	0.929	macromolecule modification
GO:0036211	0.805	protein modification process
GO:0070647	0.590	protein modification by small protein conjugation or removal
GO:0009987	0.572	cellular process
GO:0065007	0.533	biological regulation
GO:0032446	0.463	protein modification by small protein conjugation
GO:0016567	0.450	protein ubiquitination
GO:0050789	0.400	regulation of biological process
GO:0050794	0.302	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0043229	0.994	intracellular organelle
GO:0043227	0.990	membrane-bounded organelle
GO:0043231	0.980	intracellular membrane-bounded organelle
GO:0016020	0.976	membrane
GO:0012505	0.626	endomembrane system
GO:0005634	0.532	nucleus
GO:0005886	0.507	plasma membrane
GO:0070013	0.467	intracellular organelle lumen
GO:0031981	0.367	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.999	Transferases.

[back to server]