StarFunc result for job id A0AUZ9

User Input

>input (987 residues)
MTPALREATAKGISFSSLPSTMESDKMLYMESPRTVDEKLKGDTFSQMLGFPTPEPTLNT
NFVNLKHFGSPQSSKHYQTVFLMRSNSTLNKHNENYKQKKLGEPSCNKLKNILYNGSNIQ
LSKICLSHSEEFIKKEPLSDTTSQCMKDVQIILDSNITKDTNVDKVQLQNCKWYQENALL
DKVTDAEIKKGLLHCTQKKIVPGHSNVPVSSSAAEKEEEVHARLLHCVSKQKILLSQARR
TQKHLQMLLAKHVVKHYGQQMKLSMKHQLPKMKTFHEPTTILGNSLPKCTEIKPEVNTLT
AENKLWDDAKNGFARCTAAEIQRFAFSATGLLSHVEEGLDSDATDSSSDDDLDEYTLRKN
VAVNCSTEWKWLVDRARVGSRWTWLQAQISDLECKIQQLTDIHRQIRASKGIVVLEECQL
PKDILKKQMQFADQAASLNILGNPQVPQECQDPVPEQDFEMSPSSPTLLLRNIEKQSAQL
TEIINSLIAPLNLSPTSSPLSSKSCSHKCLANGIYRSASENLDELSSSSSWLLNQKHSKK
KRKDRTRLKSSSLTFMSTSARTRPLQSFHKRKLYRLSPTFYWTPQTLPSKETAFLNTTQM
PCLQSASTWSSYEHNSESYLLREHVSELDSSFHSVLSLPSDVPLHFHFETLLKKTEIKGN
LAENKFVDEYIISPSPVHSTLNQWRNGYSPICKPQIRSESSAQLLQGRKKRHLSETALGE
RTKLEESDFQHTESGSHSNFTAVSNVNVLSRIQNSSRNTARRRLRSESSYDIDNIVIPMS
LVAPAKLEKLQYKEILTPSWRMVVLQPLDEYNLGKEEIEDLSDEVFSLRHKKYEEREQAR
WSLWEQSKWHRRNSRAYSKNVEGQDLLLKEYPNNFSSSQQCAAASPPGLPSENQDLCAYG
LPSLNQSQETKSLWWERRAFPLKGEDMAALLCQDEKKDQVERSSTAFHGEIFGTSVPENG
HHPKKQSDGMEEYKTFGLGLTNVKKNR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R9Y2	0.086	0.079	2.213E-21	1105	0.268	0.240	A0A024R9Y2.pdb.gz
2	AFDB:Q54KI4	0.061	0.051	1.387E-6	1196	0.129	0.106	Q54KI4.pdb.gz	EPS15_DICDI Epidermal growth factor receptor substrate 15 homolog OS=Dictyostelium discoideum OX=44689 GN=eps15 PE=1 SV=1
3	AFDB:A0A1B0GVM0	0.081	0.097	2.787E-5	812	0.112	0.137	A0A1B0GVM0.pdb.gz	A0A1B0GVM0_HUMAN Brain enriched guanylate kinase associated OS=Homo sapiens OX=9606 GN=BEGAIN PE=1 SV=1
4	AFDB:Q5EXX3	0.049	0.045	2.979E-5	1203	0.131	0.107	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
5	AFDB:Q86Y26	0.059	0.045	8.100E-5	1132	0.145	0.126	Q86Y26.pdb.gz	NUTM1_HUMAN NUT family member 1 OS=Homo sapiens OX=9606 GN=NUTM1 PE=1 SV=2
6	AFDB:Q6ZNA4	0.045	0.045	2.354E-4	994	0.138	0.137	Q6ZNA4.pdb.gz	RN111_HUMAN E3 ubiquitin-protein ligase Arkadia OS=Homo sapiens OX=9606 GN=RNF111 PE=1 SV=3
7	AFDB:O95197	0.042	0.041	2.875E-4	1032	0.123	0.117	O95197.pdb.gz	RTN3_HUMAN Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2
8	AFDB:E7ERS3	0.058	0.059	6.841E-4	977	0.131	0.132	E7ERS3.pdb.gz	E7ERS3_HUMAN Zinc finger CCCH-type containing 18 OS=Homo sapiens OX=9606 GN=ZC3H18 PE=1 SV=1
9	AFDB:Q32MZ4	0.070	0.080	6.841E-4	808	0.104	0.127	Q32MZ4.pdb.gz	LRRF1_HUMAN Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1 PE=1 SV=2
10	AFDB:A2API8	0.064	0.068	1.091E-3	921	0.124	0.132	A2API8.pdb.gz	A2API8_MOUSE Paralemmin A kinase anchor protein OS=Mus musculus OX=10090 GN=Pakap PE=1 SV=1
11	PDB:5nrlG	0.036	0.074	4.296	372	0.025	0.067	5nrlG.pdb.gz	Structure of a pre-catalytic spliceosome.
12	PDB:7dvqZ	0.037	0.184	5.247	140	0.014	0.100	7dvqZ.pdb.gz	Structure of the activated human minor spliceosome.
13	PDB:6qlfQ	0.060	0.246	7.828	204	0.025	0.123	6qlfQ.pdb.gz
14	PDB:7pubCK	0.039	0.099	9.561	298	0.016	0.054	7pubCK.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1W2PPV8	7.60e-61	226	897	0.217	0.239	A0A1W2PPV8_HUMAN KAT8 regulatory NSL complex subunit 1 (Fragment) OS=Homo sapiens OX=9606 GN=KANSL1 PE=1 SV=1
2	A0A1W2PRB5	1.99e-60	226	1041	0.219	0.207	A0A1W2PRB5_HUMAN KAT8 regulatory NSL complex subunit 1 OS=Homo sapiens OX=9606 GN=KANSL1 PE=1 SV=1
3	Q80TG1	3.19e-57	216	1036	0.212	0.202	KANL1_MOUSE KAT8 regulatory NSL complex subunit 1 OS=Mus musculus OX=10090 GN=Kansl1 PE=1 SV=1
4	A0A3B3IT55	2.92e-35	147	1061	0.139	0.129	A0A3B3IT55_HUMAN KAT8 regulatory NSL complex subunit 1 OS=Homo sapiens OX=9606 GN=KANSL1 PE=1 SV=1
5	Q7Z3B3	3.17e-35	147	1105	0.140	0.125	KANL1_HUMAN KAT8 regulatory NSL complex subunit 1 OS=Homo sapiens OX=9606 GN=KANSL1 PE=1 SV=3
6	I3L233	1.29e-32	137	678	0.135	0.196	I3L233_HUMAN KAT8 regulatory NSL complex subunit 1 (Fragment) OS=Homo sapiens OX=9606 GN=KANSL1 PE=1 SV=2
7	A0A0B4K663	5.74e-09	62.8	1569	0.039	0.024	A0A0B4K663_DROME Non-specific lethal 1, isoform N OS=Drosophila melanogaster OX=7227 GN=nsl1 PE=1 SV=1
8	Q0KI68	5.87e-09	62.8	1548	0.039	0.025	Q0KI68_DROME Non-specific lethal 1, isoform F OS=Drosophila melanogaster OX=7227 GN=nsl1 PE=1 SV=2
9	A4V2Z1	5.93e-09	62.8	1550	0.039	0.025	A4V2Z1_DROME Non-specific lethal 1, isoform D OS=Drosophila melanogaster OX=7227 GN=nsl1 PE=1 SV=1
10	E1JIM0	5.93e-09	62.8	1549	0.039	0.025	E1JIM0_DROME Non-specific lethal 1, isoform E OS=Drosophila melanogaster OX=7227 GN=nsl1 PE=1 SV=1
11	A0A0B4K690	5.98e-09	62.8	1551	0.039	0.025	A0A0B4K690_DROME Non-specific lethal 1, isoform O OS=Drosophila melanogaster OX=7227 GN=nsl1 PE=1 SV=1
12	E2QD16	5.99e-09	62.8	1570	0.039	0.024	E2QD16_DROME Non-specific lethal 1, isoform M OS=Drosophila melanogaster OX=7227 GN=nsl1 PE=1 SV=1
13	E1JIM1	7.26e-09	62.4	936	0.039	0.041	E1JIM1_DROME Non-specific lethal 1, isoform J OS=Drosophila melanogaster OX=7227 GN=nsl1 PE=1 SV=1
14	A0A0B4K6Z4	8.32e-09	62.0	981	0.039	0.039	A0A0B4K6Z4_DROME Non-specific lethal 1, isoform L OS=Drosophila melanogaster OX=7227 GN=nsl1 PE=1 SV=1
15	A0A0B4K6I8	8.39e-09	62.0	982	0.034	0.035	A0A0B4K6I8_DROME Non-specific lethal 1, isoform K OS=Drosophila melanogaster OX=7227 GN=nsl1 PE=1 SV=1
16	Q57V64	0.093	39.3	901	0.022	0.024	Q57V64_TRYB2 RNA polymerase-associated protein CTR9 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.260 PE=4 SV=1
17	J3KSZ8	0.19	38.1	598	0.026	0.043	J3KSZ8_HUMAN MSL complex subunit 1 OS=Homo sapiens OX=9606 GN=MSL1 PE=1 SV=1
18	Q68DK7	0.23	37.7	614	0.026	0.042	MSL1_HUMAN Male-specific lethal 1 homolog OS=Homo sapiens OX=9606 GN=MSL1 PE=1 SV=3
19	Q6PDM1	0.26	37.7	616	0.026	0.042	MSL1_MOUSE Male-specific lethal 1 homolog OS=Mus musculus OX=10090 GN=Msl1 PE=1 SV=1
20	Q9VKW5	3.5	33.9	756	0.032	0.042	Q9VKW5_DROME Prolyl endopeptidase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG5355 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15275 PEHE	5e-32	122.8	PEHE domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281772

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000396749	0.903	KAT8 regulatory NSL complex subunit 3
2	9606.ENSP00000406037	0.888	Histone acetyltransferase KAT8
3	9606.ENSP00000388713	0.754	LanC-like protein 1
4	9606.ENSP00000200557	0.734	Disintegrin and metalloproteinase domain-containing protein 11
5	9606.ENSP00000415436	0.727	KAT8 regulatory NSL complex subunit 2
6	9606.ENSP00000264377	0.720	Disintegrin and metalloproteinase domain-containing protein 23
7	9606.ENSP00000332488	0.714	Signal peptide peptidase-like 2C
8	9606.ENSP00000349640	0.704	Microspherule protein 1
9	9606.ENSP00000262419	0.661	KAT8 regulatory NSL complex subunit 1
10	9606.ENSP00000340330	0.660	Histone acetyltransferase KAT5
11	9606.ENSP00000265769	0.638	Disintegrin and metalloproteinase domain-containing protein 28
12	9606.ENSP00000365200	0.633	Testis-expressed protein 30
13	9606.ENSP00000374213	0.625	E1A-binding protein p400
14	9606.ENSP00000351446	0.622	WD repeat-containing protein 5
15	9606.ENSP00000307280	0.616	Myosin light chain 1/3, skeletal muscle isoform
16	9606.ENSP00000303822	0.606	Olfactory receptor 7G2
17	9606.ENSP00000443168	0.599	Saitohin
18	9606.ENSP00000462945	0.578	Male-specific lethal 1 homolog
19	9606.ENSP00000311827	0.567	E3 ubiquitin-protein ligase MSL2
20	9606.ENSP00000258484	0.560	Enhancer of polycomb homolog 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.922	enzyme binding
GO:0035035	0.879	histone acetyltransferase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0019222	0.967	regulation of metabolic process
GO:0060255	0.964	regulation of macromolecule metabolic process
GO:0071704	0.923	organic substance metabolic process
GO:0044238	0.922	primary metabolic process
GO:0006807	0.903	nitrogen compound metabolic process
GO:0031323	0.890	regulation of cellular metabolic process
GO:0043170	0.882	macromolecule metabolic process
GO:0051171	0.881	regulation of nitrogen compound metabolic process
GO:0036211	0.865	protein modification process
GO:0080090	0.828	regulation of primary metabolic process
GO:0006475	0.787	internal protein amino acid acetylation
GO:0018193	0.780	peptidyl-amino acid modification
GO:0016570	0.769	histone modification
GO:0016573	0.758	histone acetylation
GO:0019219	0.725	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.667	positive regulation of biological process
GO:0009893	0.631	positive regulation of metabolic process
GO:0010468	0.627	regulation of gene expression
GO:0009987	0.619	cellular process
GO:0048522	0.567	positive regulation of cellular process
GO:0010604	0.561	positive regulation of macromolecule metabolic process
GO:0051173	0.557	positive regulation of nitrogen compound metabolic process
GO:0031325	0.489	positive regulation of cellular metabolic process
GO:0043967	0.476	histone H4 acetylation
GO:0009889	0.422	regulation of biosynthetic process
GO:0010556	0.397	regulation of macromolecule biosynthetic process
GO:0031326	0.385	regulation of cellular biosynthetic process
GO:2001141	0.377	regulation of RNA biosynthetic process
GO:0006355	0.374	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.996	protein-containing complex
GO:0043232	0.940	intracellular non-membrane-bounded organelle
GO:0005694	0.926	chromosome
GO:0000785	0.918	chromatin
GO:0031248	0.899	protein acetyltransferase complex
GO:0005737	0.871	cytoplasm
GO:0000123	0.844	histone acetyltransferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]