StarFunc result for job id A0AV96

User Input

>input (593 residues)
MTAEDSTAAMSSDSAAGSSAKVPEGVAGAPNEAALLALMERTGYSMVQENGQRKYGGPPP
GWEGPHPQRGCEVFVGKIPRDVYEDELVPVFEAVGRIYELRLMMDFDGKNRGYAFVMYCH
KHEAKRAVRELNNYEIRPGRLLGVCCSVDNCRLFIGGIPKMKKREEILEEIAKVTEGVLD
VIVYASAADKMKNRGFAFVEYESHRAAAMARRKLMPGRIQLWGHQIAVDWAEPEIDVDED
VMETVKILYVRNLMIETTEDTIKKSFGQFNPGCVERVKKIRDYAFVHFTSREDAVHAMNN
LNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGAAEAAQQPSYVYSCDPYTLAYYGYP
YNALIGPNRDYFVKAGSIRGRGRGAAGNRAPGPRGSYLGGYSAGRGIYSRYHEGKGKQQE
KGYELVPNLEIPTVNPVAIKPGTVAIPAIGAQYSMFPAAPAPKMIEDGKIHTVEHMISPI
AVQPDPASAAAAAAAAAAAAAAVIPTVSTPPPFQGRPITPVYTVAPNVQRIPTAGIYGAS
YVPFAAPATATIATLQKNAAAAAAMYGGYAGYIPQAFPAAAIQVPIPDVYQTY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0AV96	1.000	1.000	0.000	593	1.000	1.000	A0AV96.pdb.gz	RBM47_HUMAN RNA-binding protein 47 OS=Homo sapiens OX=9606 GN=RBM47 PE=1 SV=2
2	AFDB:Q5YD48	0.519	0.517	7.954E-59	595	0.455	0.454	Q5YD48.pdb.gz	A1CF_MOUSE APOBEC1 complementation factor OS=Mus musculus OX=10090 GN=A1cf PE=1 SV=2
3	AFDB:P86049	0.471	0.519	1.386E-55	533	0.393	0.437	P86049.pdb.gz	RBM46_MOUSE Probable RNA-binding protein 46 OS=Mus musculus OX=10090 GN=Rbm46 PE=1 SV=1
4	AFDB:Q9ASP6	0.306	0.357	1.188E-26	495	0.209	0.251	Q9ASP6.pdb.gz	HNRPQ_ARATH Heterogeneous nuclear ribonucleoprotein Q OS=Arabidopsis thaliana OX=3702 GN=LIF2 PE=1 SV=1
5	PDB:5vsuA	0.144	0.210	2.008E-15	387	0.081	0.124	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
6	AFDB:Q8IXT5	0.117	0.070	3.054E-15	1001	0.152	0.090	Q8IXT5.pdb.gz	RB12B_HUMAN RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2
7	PDB:6r5kH	0.126	0.186	5.333E-13	394	0.121	0.183	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
8	AFDB:O43719	0.131	0.104	9.160E-13	755	0.155	0.122	O43719.pdb.gz	HTSF1_HUMAN HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1
9	AFDB:Q8IJI0	0.140	0.153	2.022E-11	538	0.106	0.117	Q8IJI0.pdb.gz	Q8IJI0_PLAF7 Serine/arginine-rich splicing factor 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1022400 PE=4 SV=1
10	AFDB:Q9SVV9	0.140	0.113	7.683E-11	759	0.125	0.097	Q9SVV9.pdb.gz	AML3_ARATH Protein MEI2-like 3 OS=Arabidopsis thaliana OX=3702 GN=ML3 PE=2 SV=2
11	PDB:6y53o	0.128	0.451	3.740E-10	160	0.059	0.219	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
12	PDB:7oqcF	0.140	0.295	5.066E-10	267	0.064	0.142	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
13	PDB:5lsbA	0.123	0.385	1.185E-9	176	0.059	0.199	5lsbA.pdb.gz
14	PDB:6y5qq	0.132	0.398	7.313E-9	178	0.042	0.140	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
15	PDB:7evoD	0.130	0.374	2.180E-8	200	0.062	0.185	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
16	PDB:6ff7X	0.129	0.406	2.787E-7	171	0.069	0.240	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
17	PDB:5yzg1	0.129	0.306	5.112E-7	243	0.054	0.132	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
18	PDB:3lqvB	0.131	0.617	7.818E-7	115	0.044	0.226	3lqvB.pdb.gz	Branch Recognition by SF3b14
19	AFDB:A3AT67	0.123	0.108	1.347E-5	684	0.147	0.127	A3AT67.pdb.gz	A3AT67_ORYSJ Branchpoint-bridging protein OS=Oryza sativa subsp. japonica OX=39947 GN=OsJ_14553 PE=3 SV=1
20	AFDB:Q8C7E9	0.126	0.119	2.188E-5	632	0.128	0.120	Q8C7E9.pdb.gz	CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus OX=10090 GN=Cstf2t PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8M1NHK4	0.0	911	600	0.786	0.777	RBM47_DANRE RNA-binding protein 47 OS=Danio rerio OX=7955 GN=rbm47 PE=1 SV=1
2	A0AV96	0.0	1213	593	1.000	1.000	RBM47_HUMAN RNA-binding protein 47 OS=Homo sapiens OX=9606 GN=RBM47 PE=1 SV=2
3	B7ZLP7	0.0	1210	593	0.997	0.997	B7ZLP7_HUMAN RNA-binding protein 47 OS=Homo sapiens OX=9606 GN=RBM47 PE=1 SV=1
4	Q91WT8	0.0	1030	590	0.941	0.946	RBM47_MOUSE RNA-binding protein 47 OS=Mus musculus OX=10090 GN=Rbm47 PE=1 SV=1
5	Q9NQ94	4.21e-180	523	594	0.450	0.449	A1CF_HUMAN APOBEC1 complementation factor OS=Homo sapiens OX=9606 GN=A1CF PE=1 SV=1
6	Q5YD48	3.70e-174	508	595	0.450	0.449	A1CF_MOUSE APOBEC1 complementation factor OS=Mus musculus OX=10090 GN=A1cf PE=1 SV=2
7	Q923K9	3.65e-172	503	594	0.447	0.446	A1CF_RAT APOBEC1 complementation factor OS=Rattus norvegicus OX=10116 GN=A1cf PE=1 SV=1
8	F8W9F8	9.41e-168	492	602	0.422	0.415	F8W9F8_HUMAN APOBEC1 complementation factor OS=Homo sapiens OX=9606 GN=A1CF PE=1 SV=2
9	P86049	1.20e-150	446	533	0.376	0.418	RBM46_MOUSE Probable RNA-binding protein 46 OS=Mus musculus OX=10090 GN=Rbm46 PE=1 SV=1
10	Q8TBY0	3.96e-150	444	533	0.376	0.418	RBM46_HUMAN Probable RNA-binding protein 46 OS=Homo sapiens OX=9606 GN=RBM46 PE=1 SV=1
11	A4V364	2.92e-113	350	529	0.283	0.318	A4V364_DROME Syncrip, isoform F OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
12	A0A0B4KGK8	3.22e-113	351	569	0.282	0.293	A0A0B4KGK8_DROME Syncrip, isoform R OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
13	Q59GL1	3.81e-113	350	534	0.285	0.316	Q59GL1_HUMAN Synaptotagmin binding, cytoplasmic RNA interacting protein variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
14	Q8IN48	4.01e-113	351	571	0.282	0.292	Q8IN48_DROME Syncrip, isoform E OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
15	A8JR54	4.11e-113	350	534	0.283	0.315	A8JR54_DROME Syncrip, isoform H OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
16	A0A0B4KH24	4.23e-113	352	611	0.282	0.273	A0A0B4KH24_DROME Syncrip, isoform O OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
17	Q7TMK9	6.04e-113	352	623	0.292	0.278	HNRPQ_MOUSE Heterogeneous nuclear ribonucleoprotein Q OS=Mus musculus OX=10090 GN=Syncrip PE=1 SV=2
18	Q8IN47	7.42e-113	350	563	0.283	0.298	Q8IN47_DROME Syncrip, isoform A OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=2
19	A0A0B4KH21	1.05e-112	351	603	0.282	0.277	A0A0B4KH21_DROME Syncrip, isoform I OS=Drosophila melanogaster OX=7227 GN=Syp PE=1 SV=1
20	Q86NT3	1.13e-112	351	626	0.282	0.267	Q86NT3_DROME AT01548p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Syp PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07749 ERp29	2.5e+02	13.9	Endoplasmic reticulum protein ERp29, C-terminal domain
2	PF00076 RRM_1	1.1e-33	126.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF13893 RRM_5	13	16.9	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF16367 RRM_7	0.009	27.4	RNA recognition motif
5	PF16842 RRM_occluded	25	16.1	Occluded RNA-recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371212

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000418748	0.756	Epithelial splicing regulatory protein 2
2	9606.ENSP00000254108	0.706	RNA-binding protein FUS
3	9606.ENSP00000362287	0.681	Protein argonaute-3
4	9606.ENSP00000312663	0.678	Neuronal acetylcholine receptor subunit alpha-9
5	9606.ENSP00000336783	0.678	Trinucleotide repeat-containing gene 6C protein
6	9606.ENSP00000401946	0.671	Trinucleotide repeat-containing gene 6B protein
7	9606.ENSP00000229304	0.667	C->U-editing enzyme APOBEC-1
8	9606.ENSP00000405738	0.657	Epithelial splicing regulatory protein 1
9	9606.ENSP00000361411	0.638	Zinc finger CCHC-type containing 24
10	9606.ENSP00000362300	0.621	Protein argonaute-1
11	9606.ENSP00000324693	0.609	Grainyhead-like protein 1 homolog
12	9606.ENSP00000296424	0.594	3-hydroxybutyrate dehydrogenase type 2
13	9606.ENSP00000282486	0.592	Muscleblind-like protein 1
14	9606.ENSP00000237283	0.590	tRNA-specific adenosine deaminase 2
15	9606.ENSP00000386636	0.572	Lupus La protein
16	9606.ENSP00000216297	0.571	FACT complex subunit SPT16
17	9606.ENSP00000320866	0.571	Calreticulin
18	9606.ENSP00000225792	0.565	Probable ATP-dependent RNA helicase DDX5
19	9606.ENSP00000351108	0.559	Heterogeneous nuclear ribonucleoprotein A/B
20	9606.ENSP00000332448	0.554	Probable inactive tRNA-specific adenosine deaminase-like protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003729	1.000	mRNA binding
GO:0003730	0.970	mRNA 3'-UTR binding
GO:0030674	0.933	protein-macromolecule adaptor activity
GO:0140767	0.921	enzyme-substrate adaptor activity
GO:0019899	0.901	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.986	organic substance metabolic process
GO:0050794	0.986	regulation of cellular process
GO:0044238	0.985	primary metabolic process
GO:0044237	0.985	cellular metabolic process
GO:0006807	0.981	nitrogen compound metabolic process
GO:0010468	0.977	regulation of gene expression
GO:0043170	0.975	macromolecule metabolic process
GO:0080090	0.974	regulation of primary metabolic process
GO:0051171	0.974	regulation of nitrogen compound metabolic process
GO:0031323	0.974	regulation of cellular metabolic process
GO:0034641	0.949	cellular nitrogen compound metabolic process
GO:1901360	0.947	organic cyclic compound metabolic process
GO:0006139	0.943	nucleobase-containing compound metabolic process
GO:0048519	0.938	negative regulation of biological process
GO:0043488	0.928	regulation of mRNA stability
GO:0016070	0.917	RNA metabolic process
GO:0043489	0.909	RNA stabilization
GO:0048255	0.900	mRNA stabilization
GO:0009451	0.879	RNA modification
GO:0016553	0.848	base conversion or substitution editing
GO:0048522	0.660	positive regulation of cellular process
GO:0043484	0.505	regulation of RNA splicing
GO:0009889	0.375	regulation of biosynthetic process
GO:0048583	0.360	regulation of response to stimulus
GO:0031326	0.352	regulation of cellular biosynthetic process
GO:0032502	0.335	developmental process
GO:0010467	0.300	gene expression
GO:0010556	0.300	regulation of macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005737	0.963	cytoplasm
GO:0031981	0.955	nuclear lumen
GO:0005654	0.945	nucleoplasm
GO:0032991	0.927	protein-containing complex
GO:0140513	0.725	nuclear protein-containing complex
GO:1902494	0.468	catalytic complex
GO:0030895	0.372	apolipoprotein B mRNA editing enzyme complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]