StarFunc result for job id A0AVI2

User Input

>input (2057 residues)
MLRLVVQSAKIDPPLAPLPRPCMSIDFRDIKKRTRVVEGNDPVWNETLIWHLWNRPLEND
SFLQVTLQDMGSQKKERFIGLATVLLKPLLKQPSEVLFVKDLTLLNHSMKPTDCTVTLQV
AHMSNQDIEKTGAEDHLGITAREAASQKLMVPGSTAHRALSSKPQHFQVRVKVFEARQLM
GNNIKPVVKVSIAGQQHQTRIKMGNNPFFNEIFFQNFHEVPAKFFDETILIQVVNSSAMR
YKAEIGRFQTDIGFIYHSPGHTLLRKWLGLCQPNNPGSGVTGYLKVTIYALGVGDQALID
QKLLYGTDDTDIQIFKSAVVPINMAYLQLFIYCAEDLHLKKHQSVNPQLEVELIGEKLRT
HMQTQTDNPIWNQILTFRIQLPCLSSYIKFRVLDCRKKDCPDEIGTASLSLNQISSTGEE
IEGVYSGFLPCFGPSFLTLHGGKKAPFRIQEEGACIPDSVRDGLAYRGRVFLELITQIKS
YQDSTIKDLSHEVTRIEKHQNRQKYGLCVIFLSCTMMPNFKELIHFEVSIGHYGNKMDLN
YKPLVSSTPYSPVIYDGNIYHYVPWYNTKPVVAVTSNWEDVSFRMNCLNLLHFTRDRLKA
NLDTLKSTRNPKDPALLYQWEKLLRELAEDCKRPLPCMTYQPKATSLDRKRWQLRSLLLQ
ELAQKAKQAKPKDMVATAEDWLYRLNTVLPEPQMGLPDVMIWLVAKEQRVAYAQVPAHSV
LFSPAGALHSGRLCGKIQTLFLQYPEGEGQKDVLPAHLRVCMWLGNVTDSKDLQLLRQGD
TAVYAEMYENQAKYKDQWGQQGLYHCPNFSDVMGNKTLPMTDFQPPLGWHWQDSWTVEPQ
RRLLLDIDINKSQVLEEVYENQGRDTRGAWGPAAIPNTDVNGQPMEARENVKCPQGWHFK
KDWVVELNHAVDSKGWEYGVGIPPSGLPQVWSPVEKTYHSCRRRRWARVRFRNHGELSHE
QETLSFLQLGLAKGEEEGWEYDTFGSKFHLNPQPQSRFRRRCWRRRLAPNKDKGIAPIFL
LEGSLAMDLKYHAGKEEDSKTWPWGLDRQFRDPQRQDTRPPNLPFIYCTFNKPHYYQLFC
YIYQARNLVSNQILTFQGPFIRVVFLNHSQCTQTLRSSAGPTWAQTLIFQHLLLYENPQD
TKESPPLVVLELWQRDFWGKESLWGRSVWPPMVWLDLQDRILPPMRWHPLVKELGKEEGE
ILASCELILQTEKLGEKQLPILSVPWKNGAYTLPKSIQPTIKRMAIEILAWGLRNMKKAS
SPQLLVEFGEESLRTEPIRDFQTNPNFPESESVLVLTVLMPTEEAYALPLVVKVVDNWAF
GQQTVTGQANIDFLQPYFCDPWAQDYMHPKLPTLSEKKHQDFLGYLYRKFWFKSSKAEDE
YEHEVDWWSKLFWATDEHKSLKYKYKDYHTLKVYECELEAVPAFQGLQDFCQTFKLYQEQ
PKLDSPVVGEFKGLFRIYPFPENPEAPKPPLQFLVWPEREDFPQPCLVRVYMVRAINLQP
QDYNGLCDPYVILKLGKTELGNRDMYQPNTLDPIFGMMFELTCNIPLEKDLEIQLYDFDL
FSPDDKIGTTVIDLENRLLSGFGAHCGLSKSYCQSGPFRWRDQMPPSYLLERYAKRKGLP
PPLFSPEEDAVFYNGKKFKLQSFEPKTPTVHGLGPKKERLALYLLHTQGLVPEHVETRTL
YSHSQPGIDQGKVQMWVDIFPKKLGPPGPQVNINPRKPKRYELRCIIWKTANVDLVDDNL
SREKTSDIYIKGWLYGLEKDMQKTDIHYHSLTGEADFNWRFIFTMDYLAAERTCVQSQKD
YIWSLDATSMKFPARLIIQVWDNDIFSPDDFLGVLELDLSDMPLPARHAKQCSIRMMDAD
PKWPYFIQYKHFSLFKKKTVTGWWPCQVLDGGKWRLSGKVKMSLEILSEKEALIKPAGRG
QSEPNQYPTLHPPLRTNTSFTWLRSPVQNFCYIFWKRYRFKLIAFMVISIIALMLFNFIY
SAPHYLAMSWIKPQLQLYPPIKIFNIINSLNTSNASSSILPTQDPNLKPTIDHEWKLHPG
PTNHLSDIFPELPAPGD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E0CZ42	0.502	0.546	0.000	1862	0.258	0.285	E0CZ42.pdb.gz	E0CZ42_MOUSE Fer-1-like 6 (C. elegans) OS=Mus musculus OX=10090 GN=Fer1l6 PE=1 SV=1
2	AFDB:E7F4H1	0.638	0.627	0.000	2097	0.390	0.382	E7F4H1.pdb.gz	E7F4H1_DANRE Dysferlin OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=2 SV=2
3	AFDB:E7FGH7	0.481	0.540	0.000	1790	0.268	0.308	E7FGH7.pdb.gz
4	AFDB:F8W4A8	0.505	0.573	0.000	1773	0.260	0.301	F8W4A8.pdb.gz	F8W4A8_DANRE Otoferlin b OS=Danio rerio OX=7955 GN=otofb PE=4 SV=1
5	AFDB:Q17388	0.632	0.638	0.000	2034	0.224	0.226	Q17388.pdb.gz	FER1_CAEEL Sperm vesicle fusion protein fer-1 OS=Caenorhabditis elegans OX=6239 GN=fer-1 PE=2 SV=1
6	AFDB:Q9ERC5	0.527	0.542	0.000	1993	0.276	0.284	Q9ERC5.pdb.gz	OTOF_RAT Otoferlin OS=Rattus norvegicus OX=10116 GN=Otof PE=1 SV=2
7	AFDB:Q9ESD7	0.704	0.694	0.000	2090	0.412	0.406	Q9ESD7.pdb.gz	DYSF_MOUSE Dysferlin OS=Mus musculus OX=10090 GN=Dysf PE=1 SV=3
8	AFDB:Q9ESF1	0.544	0.558	0.000	1997	0.274	0.282	Q9ESF1.pdb.gz	OTOF_MOUSE Otoferlin OS=Mus musculus OX=10090 GN=Otof PE=1 SV=1
9	AFDB:Q9NZM1	0.708	0.707	0.000	2061	0.414	0.413	Q9NZM1.pdb.gz	MYOF_HUMAN Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1
10	AFDB:B7Z0E5	0.441	0.528	2.177E-101	1647	0.179	0.223	B7Z0E5.pdb.gz	B7Z0E5_DROME Misfire, isoform F OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
11	PDB:6kxkD	0.063	0.190	1.289E-7	553	0.023	0.085	6kxkD.pdb.gz	Crystal Structure of an Arabidopsis Copine providing insights into this protein family
12	PDB:5iz5B	0.054	0.142	6.377E-7	746	0.013	0.035	5iz5B.pdb.gz
13	PDB:5iz5A	0.055	0.130	5.921E-6	757	0.023	0.062	5iz5A.pdb.gz
14	PDB:5a50A	0.058	0.620	6.524E-6	165	0.017	0.212	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
15	PDB:5ixcA	0.053	0.151	1.487E-5	684	0.024	0.073	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
16	PDB:4rj9A	0.054	0.566	2.413E-5	161	0.016	0.205	4rj9A.pdb.gz
17	PDB:5a52A	0.056	0.635	2.413E-5	154	0.018	0.240	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
18	PDB:5izrC	0.052	0.151	2.659E-5	659	0.016	0.049	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
19	PDB:1cjyA	0.052	0.159	6.674E-5	633	0.008	0.025	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
20	PDB:3nsjA	0.053	0.189	2.135E-4	530	0.015	0.057	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A6X1	0.0	1392	2029	0.392	0.397	D4A6X1_RAT Dysferlin OS=Rattus norvegicus OX=10116 GN=Dysf PE=3 SV=2
2	E7F4H1	0.0	1360	2097	0.392	0.385	E7F4H1_DANRE Dysferlin OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=2 SV=2
3	F1QIS3	0.0	1370	2088	0.395	0.389	F1QIS3_DANRE Dysferlin isoform X9 OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=3 SV=3
4	F6IA09	0.0	1349	2088	0.391	0.386	F6IA09_DANRE Dysferlin OS=Danio rerio OX=7955 GN=si:rp71-50c18.1 PE=2 SV=1
5	O75923	0.0	1432	2080	0.415	0.411	DYSF_HUMAN Dysferlin OS=Homo sapiens OX=9606 GN=DYSF PE=1 SV=1
6	Q69ZN7	0.0	1522	2048	0.412	0.414	MYOF_MOUSE Myoferlin OS=Mus musculus OX=10090 GN=Myof PE=1 SV=2
7	Q9ESD7	0.0	1423	2090	0.419	0.412	DYSF_MOUSE Dysferlin OS=Mus musculus OX=10090 GN=Dysf PE=1 SV=3
8	Q9NZM1	0.0	1510	2061	0.414	0.413	MYOF_HUMAN Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1
9	Q9ESF1	7.06e-118	418	1997	0.119	0.122	OTOF_MOUSE Otoferlin OS=Mus musculus OX=10090 GN=Otof PE=1 SV=1
10	Q9ERC5	1.06e-117	418	1993	0.117	0.121	OTOF_RAT Otoferlin OS=Rattus norvegicus OX=10116 GN=Otof PE=1 SV=2
11	Q5SPC5	1.12e-117	417	1992	0.117	0.121	OTOF_DANRE Otoferlin OS=Danio rerio OX=7955 GN=otof PE=3 SV=1
12	F8W4A8	7.40e-117	413	1773	0.116	0.134	F8W4A8_DANRE Otoferlin b OS=Danio rerio OX=7955 GN=otofb PE=4 SV=1
13	E0CZ42	1.35e-116	413	1862	0.116	0.128	E0CZ42_MOUSE Fer-1-like 6 (C. elegans) OS=Mus musculus OX=10090 GN=Fer1l6 PE=1 SV=1
14	Q9HC10	2.19e-116	414	1997	0.118	0.122	OTOF_HUMAN Otoferlin OS=Homo sapiens OX=9606 GN=OTOF PE=1 SV=3
15	Q17388	3.86e-86	317	2034	0.178	0.180	FER1_CAEEL Sperm vesicle fusion protein fer-1 OS=Caenorhabditis elegans OX=6239 GN=fer-1 PE=2 SV=1
16	B2D6N9	2.62e-84	311	1907	0.172	0.186	B2D6N9_CAEEL C2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=fer-1 PE=3 SV=1
17	B7Z0E8	1.94e-78	276	648	0.093	0.296	B7Z0E8_DROME Misfire, isoform J OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
18	B7Z0E7	6.41e-75	278	1351	0.093	0.142	B7Z0E7_DROME Misfire, isoform D OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
19	B7Z0E6	1.99e-74	277	1439	0.093	0.133	B7Z0E6_DROME Misfire, isoform I OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1
20	B7Z0E5	2.74e-74	278	1647	0.093	0.117	B7Z0E5_DROME Misfire, isoform F OS=Drosophila melanogaster OX=7227 GN=mfr PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07162 B9-C2	4.5e+02	12.4	Ciliary basal body-associated, B9 protein
2	PF00168 C2	2.5e-58	206.1	C2 domain
3	PF08165 FerA	2.4e-05	35.5	FerA (NUC095) domain
4	PF08150 FerB	2.9e-22	90.4	FerB (NUC096) domain
5	PF08151 FerI	3.4	19.1	FerI (NUC094) domain
6	PF16165 Ferlin_C	2.6e-16	71.4	Ferlin C-terminus
7	PF00792 PI3K_C2	62	14.9	Phosphoinositide 3-kinase C2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008972716.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008964990.1	0.592	Belongs to the TRAFAC class dynamin-like GTPase superfamily. Dynamin/Fzo/YdjA family
2	9597.XP_008952265.1	0.580	Belongs to the TRAFAC class dynamin-like GTPase superfamily. Dynamin/Fzo/YdjA family
3	9597.XP_008963068.1	0.574	Polycystic kidney disease and receptor for egg jelly-related protein
4	9597.XP_003827209.1	0.531	Belongs to the TRAFAC class dynamin-like GTPase superfamily. Dynamin/Fzo/YdjA family

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005543	0.950	phospholipid binding
GO:0043167	0.631	ion binding
GO:0046872	0.476	metal ion binding
GO:0005509	0.402	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0071840	0.839	cellular component organization or biogenesis
GO:0050789	0.834	regulation of biological process
GO:0016043	0.829	cellular component organization
GO:0032502	0.616	developmental process
GO:0050794	0.591	regulation of cellular process
GO:0032501	0.568	multicellular organismal process
GO:0019953	0.508	sexual reproduction
GO:0050896	0.433	response to stimulus
GO:0048856	0.307	anatomical structure development
GO:0007009	0.300	plasma membrane organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005622	0.998	intracellular anatomical structure
GO:0005737	0.990	cytoplasm
GO:0012505	0.983	endomembrane system
GO:0005886	0.982	plasma membrane
GO:0043226	0.976	organelle
GO:0043231	0.966	intracellular membrane-bounded organelle
GO:0031982	0.905	vesicle
GO:0031090	0.825	organelle membrane
GO:0031410	0.501	cytoplasmic vesicle
GO:0005829	0.422	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]