StarFunc result for job id A0AVK6

User Input

>input (867 residues)
MENEKENLFCEPHKRGLMKTPLKESTTANIVLAEIQPDFGPLTTPTKPKEGSQGEPWTPT
ANLKMLISAVSPEIRNRDQKRGLFDNRSGLPEAKDCIHEHLSGDEFEKSQPSRKEKSLGL
LCHKFLARYPNYPNPAVNNDICLDEVAEELNVERRRIYDIVNVLESLHMVSRLAKNRYTW
HGRHNLNKTLGTLKSIGEENKYAEQIMMIKKKEYEQEFDFIKSYSIEDHIIKSNTGPNGH
PDMCFVELPGVEFRAASVNSRKDKSLRVMSQKFVMLFLVSTPQIVSLEVAAKILIGEDHV
EDLDKSKFKTKIRRLYDIANVLSSLDLIKKVHVTEERGRKPAFKWTGPEISPNTSGSSPV
IHFTPSDLEVRRSSKENCAKNLFSTRGKPNFTRHPSLIKLVKSIESDRRKINSAPSSPIK
TNKAESSQNSAPFPSKMAQLAAICKMQLEEQSSESRQKVKVQLARSGPCKPVAPLDPPVN
AEMELTAPSLIQPLGMVPLIPSPLSSAVPLILPQAPSGPSYAIYLQPTQAHQSVTPPQGL
SPTVCTTHSSKATGSKDSTDATTEKAANDTSKASASTRPGSLLPAPERQGAKSRTREPAG
ERGSKRASMLEDSGSKKKFKEDLKGLENVSATLFPSGYLIPLTQCSSLGAESILSGKENS
SALSPNHRIYSSPIAGVIPVTSSELTAVNFPSFHVTPLKLMVSPTSVAAVPVGNSPALAS
SHPVPIQNPSSAIVNFTLQHLGLISPNVQLSASPGSGIVPVSPRIESVNVAPENAGTQQG
RATNYDSPVPGQSQPNGQSVAVTGAQQPVPVTPKGSQLVAESFFRTPGGPTKPTSSSCMD
FEGANKTSLGTLFVPQRKLEVSTEDVH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0AVK6	1.000	1.000	0.000	867	1.000	1.000	A0AVK6.pdb.gz	E2F8_HUMAN Transcription factor E2F8 OS=Homo sapiens OX=9606 GN=E2F8 PE=1 SV=1
2	AFDB:Q58FA4	0.408	0.411	3.056E-92	860	0.828	0.835	Q58FA4.pdb.gz	E2F8_MOUSE Transcription factor E2F8 OS=Mus musculus OX=10090 GN=E2f8 PE=1 SV=1
3	AFDB:Q96AV8	0.298	0.285	6.303E-39	911	0.349	0.333	Q96AV8.pdb.gz	E2F7_HUMAN Transcription factor E2F7 OS=Homo sapiens OX=9606 GN=E2F7 PE=1 SV=3
4	AFDB:Q6S7F2	0.289	0.278	2.687E-38	904	0.347	0.333	Q6S7F2.pdb.gz	E2F7_MOUSE Transcription factor E2F7 OS=Mus musculus OX=10090 GN=E2f7 PE=1 SV=1
5	AFDB:Q9NPG3	0.054	0.049	3.715E-5	1134	0.168	0.129	Q9NPG3.pdb.gz	UBN1_HUMAN Ubinuclein-1 OS=Homo sapiens OX=9606 GN=UBN1 PE=1 SV=2
6	AFDB:Q6ZU65	0.057	0.043	3.359E-4	1347	0.144	0.093	Q6ZU65.pdb.gz	UBN2_HUMAN Ubinuclein-2 OS=Homo sapiens OX=9606 GN=UBN2 PE=1 SV=2
7	AFDB:X1WE18	0.055	0.045	3.544E-4	1085	0.137	0.110	X1WE18.pdb.gz	KANK2_DANRE KN motif and ankyrin repeat domain-containing protein 2 OS=Danio rerio OX=7955 GN=kank2 PE=3 SV=1
8	AFDB:P34706	0.049	0.029	5.162E-4	2150	0.155	0.062	P34706.pdb.gz	SDC3_CAEEL Zinc finger protein sdc-3 OS=Caenorhabditis elegans OX=6239 GN=sdc-3 PE=1 SV=2
9	AFDB:Q96M83	0.055	0.041	1.219E-3	1385	0.150	0.094	Q96M83.pdb.gz	CCDC7_HUMAN Coiled-coil domain-containing protein 7 OS=Homo sapiens OX=9606 GN=CCDC7 PE=1 SV=3
10	AFDB:Q9DCB4	0.065	0.069	1.357E-3	807	0.137	0.147	Q9DCB4.pdb.gz	ARP21_MOUSE cAMP-regulated phosphoprotein 21 OS=Mus musculus OX=10090 GN=Arpp21 PE=1 SV=2
11	PDB:2xv4S	0.075	0.137	5.102E-2	399	0.024	0.053	2xv4S.pdb.gz
12	PDB:5afqB	0.077	0.129	5.102E-2	444	0.035	0.068	5afqB.pdb.gz	Structural Analysis of Human Rpc32Beta - Rpc62 Complex.
13	PDB:7o4iW	0.072	0.144	9.718E-2	312	0.057	0.157	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
14	PDB:4p9uE	0.084	0.190	1.025E-1	272	0.036	0.114	4p9uE.pdb.gz	The 40-residue insertion in Vibrio cholerae FadR facilitates binding of an additional fatty acyl-CoA ligand.
15	PDB:4ev0D	0.069	0.221	2.175E-1	214	0.020	0.079	4ev0D.pdb.gz	Crystal Structure of T. thermophilius Catabolite Activator Protein
16	PDB:3cuqA	0.070	0.224	3.167E-1	219	0.038	0.151	3cuqA.pdb.gz
17	PDB:4fx0B	0.064	0.320	3.926E-1	135	0.015	0.096	4fx0B.pdb.gz
18	PDB:7a6hO	0.072	0.109	3.926E-1	512	0.030	0.051	7a6hO.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
19	PDB:7dn3O	0.080	0.135	4.143E-1	443	0.027	0.052	7dn3O.pdb.gz	Structure of human RNA polymerase III elongation complex.
20	PDB:5xohA	0.071	0.162	4.612E-1	348	0.015	0.037	5xohA.pdb.gz	Crystal structure of bergaptol o-methyltransferase complex

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0AVK6	0.0	1772	867	1.000	1.000	E2F8_HUMAN Transcription factor E2F8 OS=Homo sapiens OX=9606 GN=E2F8 PE=1 SV=1
2	Q58FA4	0.0	1431	860	0.832	0.838	E2F8_MOUSE Transcription factor E2F8 OS=Mus musculus OX=10090 GN=E2f8 PE=1 SV=1
3	F1QZ88	2.37e-169	517	917	0.352	0.333	E2F8_DANRE Transcription factor E2F8 OS=Danio rerio OX=7955 GN=e2f8 PE=3 SV=1
4	F8VSE7	5.68e-117	373	693	0.270	0.338	F8VSE7_HUMAN E2F transcription factor 7 (Fragment) OS=Homo sapiens OX=9606 GN=E2F7 PE=1 SV=1
5	Q96AV8	4.19e-115	374	911	0.270	0.257	E2F7_HUMAN Transcription factor E2F7 OS=Homo sapiens OX=9606 GN=E2F7 PE=1 SV=3
6	Q6S7F2	8.37e-111	363	904	0.382	0.366	E2F7_MOUSE Transcription factor E2F7 OS=Mus musculus OX=10090 GN=E2f7 PE=1 SV=1
7	Q5RIX9	1.17e-86	293	723	0.248	0.297	E2F7_DANRE Transcription factor E2F7 OS=Danio rerio OX=7955 GN=e2f7 PE=1 SV=2
8	Q9LFQ9	6.72e-36	142	359	0.107	0.259	E2FD_ARATH E2F transcription factor-like E2FD OS=Arabidopsis thaliana OX=3702 GN=E2FD PE=1 SV=1
9	Q8RWL0	1.52e-33	134	354	0.097	0.237	E2FF_ARATH E2F transcription factor-like E2FF OS=Arabidopsis thaliana OX=3702 GN=E2FF PE=2 SV=1
10	Q20619	1.28e-28	124	600	0.101	0.147	EFL3_CAEEL Transcription factor efl-3 OS=Caenorhabditis elegans OX=6239 GN=efl-3 PE=2 SV=2
11	Q8LSZ4	2.54e-16	84.3	403	0.054	0.117	E2FE_ARATH E2F transcription factor-like E2FE OS=Arabidopsis thaliana OX=3702 GN=E2FE PE=1 SV=1
12	F8VXV5	9.08e-14	70.5	115	0.045	0.339	F8VXV5_HUMAN E2F transcription factor 7 (Fragment) OS=Homo sapiens OX=9606 GN=E2F7 PE=1 SV=1
13	O35261	5.35e-10	65.1	457	0.035	0.066	E2F3_MOUSE Transcription factor E2F3 OS=Mus musculus OX=10090 GN=E2f3 PE=1 SV=2
14	O00716	6.52e-10	64.7	465	0.035	0.065	E2F3_HUMAN Transcription factor E2F3 OS=Homo sapiens OX=9606 GN=E2F3 PE=1 SV=1
15	Q9FV71	1.05e-09	64.3	469	0.040	0.075	E2FB_ARATH Transcription factor E2FB OS=Arabidopsis thaliana OX=3702 GN=E2FB PE=1 SV=1
16	Q01094	5.38e-09	61.6	437	0.040	0.080	E2F1_HUMAN Transcription factor E2F1 OS=Homo sapiens OX=9606 GN=E2F1 PE=1 SV=1
17	Q14209	1.69e-08	60.1	437	0.038	0.076	E2F2_HUMAN Transcription factor E2F2 OS=Homo sapiens OX=9606 GN=E2F2 PE=1 SV=1
18	Q9FNY0	4.08e-08	59.3	485	0.035	0.062	E2FA_ARATH Transcription factor E2FA OS=Arabidopsis thaliana OX=3702 GN=E2FA PE=1 SV=1
19	Q6DE14	4.59e-08	58.5	375	0.047	0.109	E2F4_XENLA Transcription factor E2F4 OS=Xenopus laevis OX=8355 GN=e2f4 PE=1 SV=1
20	Q61501	5.42e-08	58.5	430	0.033	0.067	E2F1_MOUSE Transcription factor E2F1 OS=Mus musculus OX=10090 GN=E2f1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04182 B-block_TFIIIC	2.7e+02	13.2	B-block binding subunit of TFIIIC
2	PF02319 E2F_TDP	4e-40	146.8	E2F/DP family winged-helix DNA-binding domain
3	PF01978 TrmB	1	20.6	Sugar-specific transcriptional regulator TrmB
4	PF04297 UPF0122	64	15.2	Putative helix-turn-helix protein, YlxM / p13 like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481103

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345571	0.951	Transcription factor E2F1
2	9606.ENSP00000274026	0.946	Cyclin-A2
3	9606.ENSP00000353770	0.943	Ribonucleoside-diphosphate reductase subunit M2
4	9606.ENSP00000362146	0.943	Borealin
5	9606.ENSP00000362768	0.943	Retinoblastoma-like protein 1
6	9606.ENSP00000247191	0.934	Disks large-associated protein 5
7	9606.ENSP00000323246	0.933	Transcription factor E2F7
8	9606.ENSP00000260731	0.932	Kinesin-like protein KIF11
9	9606.ENSP00000287598	0.932	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
10	9606.ENSP00000411532	0.930	DNA topoisomerase 2-alpha
11	9606.ENSP00000324020	0.923	Kinesin-like protein KIF15
12	9606.ENSP00000357643	0.916	Proliferation marker protein Ki-67
13	9606.ENSP00000361298	0.890	Kinesin-like protein KIF2C
14	9606.ENSP00000356379	0.872	Abnormal spindle-like microcephaly-associated protein
15	9606.ENSP00000323300	0.868	Sperm-associated antigen 5
16	9606.ENSP00000302530	0.865	Mitotic checkpoint serine/threonine-protein kinase BUB1
17	9606.ENSP00000378699	0.862	Cyclin-dependent kinase 1
18	9606.ENSP00000342307	0.860	Forkhead box protein M1
19	9606.ENSP00000269305	0.859	Cellular tumor antigen p53
20	9606.ENSP00000267163	0.843	Retinoblastoma-associated protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001217	0.999	DNA-binding transcription repressor activity
GO:0000981	0.998	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.998	cis-regulatory region sequence-specific DNA binding
GO:0000977	0.995	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001227	0.993	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000978	0.979	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0031323	0.981	regulation of cellular metabolic process
GO:0048856	0.971	anatomical structure development
GO:0045892	0.968	negative regulation of DNA-templated transcription
GO:0051173	0.965	positive regulation of nitrogen compound metabolic process
GO:0006357	0.963	regulation of transcription by RNA polymerase II
GO:0045935	0.960	positive regulation of nucleobase-containing compound metabolic process
GO:0002040	0.957	sprouting angiogenesis
GO:0010604	0.956	positive regulation of macromolecule metabolic process
GO:0000122	0.865	negative regulation of transcription by RNA polymerase II
GO:0009987	0.846	cellular process
GO:0010557	0.739	positive regulation of macromolecule biosynthetic process
GO:0031328	0.738	positive regulation of cellular biosynthetic process
GO:1902680	0.710	positive regulation of RNA biosynthetic process
GO:0045893	0.677	positive regulation of DNA-templated transcription
GO:0045944	0.550	positive regulation of transcription by RNA polymerase II
GO:0007049	0.462	cell cycle
GO:0051726	0.383	regulation of cell cycle
GO:0010564	0.346	regulation of cell cycle process
GO:0000278	0.342	mitotic cell cycle
GO:0022402	0.330	cell cycle process
GO:0050896	0.328	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005829	0.988	cytosol
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0005730	0.745	nucleolus
GO:0032991	0.549	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]