StarFunc result for job id A0AVT1

User Input

>input (1052 residues)
MEGSEPVAAHQGEEASCSSWGTGSTNKNLPIMSTASVEIDDALYSRQRYVLGDTAMQKMA
KSHVFLSGMGGLGLEIAKNLVLAGIKAVTIHDTEKCQAWDLGTNFFLSEDDVVNKRNRAE
AVLKHIAELNPYVHVTSSSVPFNETTDLSFLDKYQCVVLTEMKLPLQKKINDFCRSQCPP
IKFISADVHGIWSRLFCDFGDEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLE
TGQFLTFREINGMTGLNGSIQQITVISPFSFSIGDTTELEPYLHGGIAVQVKTPKTVFFE
SLERQLKHPKCLIVDFSNPEAPLEIHTAMLALDQFQEKYSRKPNVGCQQDSEELLKLATS
ISETLEEKPDVNADIVHWLSWTAQGFLSPLAAAVGGVASQEVLKAVTGKFSPLCQWLYLE
AADIVESLGKPECEEFLPRGDRYDALRACIGDTLCQKLQNLNIFLVGCGAIGCEMLKNFA
LLGVGTSKEKGMITVTDPDLIEKSNLNRQFLFRPHHIQKPKSYTAADATLKINSQIKIDA
HLNKVCPTTETIYNDEFYTKQDVIITALDNVEARRYVDSRCLANLRPLLDSGTMGTKGHT
EVIVPHLTESYNSHRDPPEEEIPFCTLKSFPAAIEHTIQWARDKFESSFSHKPSLFNKFW
QTYSSAEEVLQKIQSGHSLEGCFQVIKLLSRRPRNWSQCVELARLKFEKYFNHKALQLLH
CFPLDIRLKDGSLFWQSPKRPPSPIKFDLNEPLHLSFLQNAAKLYATVYCIPFAEEDLSA
DALLNILSEVKIQEFKPSNKVVQTDETARKPDHVPISSEDERNAIFQLEKAILSNEATKS
DLQMAVLSFEKDDDHNGHIDFITAASNLRAKMYSIEPADRFKTKRIAGKIIPAIATTTAT
VSGLVALEMIKVTGGYPFEAYKNCFLNLAIPIVVFTETTEVRKTKIRNGISFTIWDRWTV
HGKEDFTLLDFINAVKEKYGIEPTMVVQGVKMLYVPVMPGHAKRLKLTMHKLVKPTTEKK
YVDLTVSFAPDIDGDEDLPGPPVRYYFSHDTD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7pvnB	0.916	0.972	0.000	990	0.940	0.999	7pvnB.pdb.gz	Structures of UBA6 explain its dual specificity for ubiquitin and FAT10.
2	PDB:7solA	0.929	0.966	0.000	1011	0.960	0.999	7solA.pdb.gz	Crystal structures reveal catalytic and regulatory mechanisms of the dual-specificity ubiquitin/FAT10 E1 enzyme Uba6.
3	AFDB:A0A024R1A3	0.891	0.886	0.000	1058	0.415	0.413	A0A024R1A3.pdb.gz	A0A024R1A3_HUMAN E1 ubiquitin-activating enzyme OS=Homo sapiens OX=9606 PE=2 SV=1
4	AFDB:A0AVT1	1.000	1.000	0.000	1052	1.000	1.000	A0AVT1.pdb.gz	UBA6_HUMAN Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6 PE=1 SV=1
5	AFDB:F1RCA1	0.879	0.874	0.000	1058	0.422	0.420	F1RCA1.pdb.gz
6	AFDB:P31254	0.889	0.884	0.000	1058	0.413	0.411	P31254.pdb.gz	UBA1Y_MOUSE Ubiquitin-like modifier-activating enzyme 1 Y OS=Mus musculus OX=10090 GN=Uba1y PE=1 SV=2
7	AFDB:P92974	0.919	0.898	0.000	1077	0.379	0.370	P92974.pdb.gz	UBE12_ARATH Ubiquitin-activating enzyme E1 2 OS=Arabidopsis thaliana OX=3702 GN=UBA2 PE=1 SV=1
8	AFDB:P93028	0.911	0.888	0.000	1080	0.372	0.362	P93028.pdb.gz	UBE11_ARATH Ubiquitin-activating enzyme E1 1 OS=Arabidopsis thaliana OX=3702 GN=UBA1 PE=1 SV=1
9	AFDB:Q55C16	0.903	0.934	0.000	1017	0.410	0.424	Q55C16.pdb.gz	UBA1_DICDI Ubiquitin-like modifier-activating enzyme 1 OS=Dictyostelium discoideum OX=44689 GN=uba1 PE=3 SV=1
10	AFDB:Q8C7R4	0.971	0.970	0.000	1053	0.890	0.889	Q8C7R4.pdb.gz	UBA6_MOUSE Ubiquitin-like modifier-activating enzyme 6 OS=Mus musculus OX=10090 GN=Uba6 PE=1 SV=1
11	AFDB:Q8T0L3	0.878	0.779	0.000	1191	0.408	0.360	Q8T0L3.pdb.gz	Q8T0L3_DROME E1 ubiquitin-activating enzyme OS=Drosophila melanogaster OX=7227 GN=Uba1 PE=1 SV=1
12	AFDB:P22515	0.890	0.914	1.194E-103	1024	0.407	0.418	P22515.pdb.gz	UBA1_YEAST Ubiquitin-activating enzyme E1 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBA1 PE=1 SV=2
13	PDB:6dc6C	0.870	0.917	6.731E-102	996	0.406	0.429	6dc6C.pdb.gz	Crystal structure of a human ubiquitin E1-ubiquitin complex reveals conserved functional elements essential for activity.
14	PDB:5l6iA	0.877	0.915	7.990E-99	1007	0.398	0.416	5l6iA.pdb.gz	Dissecting the Specificity of Adenosyl Sulfamate Inhibitors Targeting the Ubiquitin-Activating Enzyme.
15	PDB:4ii3A	0.880	0.938	2.965E-97	986	0.390	0.416	4ii3A.pdb.gz	Structure of a ubiquitin E1-E2 complex: insights to E1-E2 thioester transfer.
16	PDB:7k5jI	0.836	0.895	1.993E-95	979	0.389	0.418	7k5jI.pdb.gz	Crystal structures of an E1-E2-ubiquitin thioester mimetic reveal molecular mechanisms of transthioesterification.
17	PDB:3kycB	0.300	0.557	3.057E-24	548	0.137	0.263	3kycB.pdb.gz	Active site remodelling accompanies thioester bond formation in the SUMO E1.
18	PDB:6xoiB	0.282	0.714	2.324E-21	403	0.123	0.320	6xoiB.pdb.gz	Discovery of TAK-981, a First-in-Class Inhibitor of SUMO-Activating Enzyme for the Treatment of Cancer.
19	PDB:6cwyD	0.199	0.397	4.313E-20	487	0.125	0.269	6cwyD.pdb.gz	Molecular mechanism of a covalent allosteric inhibitor of SUMO E1 activating enzyme.
20	PDB:2nvuB	0.281	0.364	6.401E-18	789	0.121	0.161	2nvuB.pdb.gz	Basis for a ubiquitin-like protein thioester switch toggling E1-E2 affinity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A024R1A3	783	1058	0.414	0.412	A0A024R1A3_HUMAN E1 ubiquitin-activating enzyme OS=Homo sapiens OX=9606 PE=2 SV=1
2	A0A0B4KF46	736	1008	0.411	0.429	A0A0B4KF46_DROME E1 ubiquitin-activating enzyme OS=Drosophila melanogaster OX=7227 GN=Uba1 PE=1 SV=1
3	A0A8I6A544	764	1057	0.413	0.412	A0A8I6A544_RAT E1 ubiquitin-activating enzyme OS=Rattus norvegicus OX=10116 GN=Uba1y PE=3 SV=1
4	A0AVT1	2190	1052	1.000	1.000	UBA6_HUMAN Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6 PE=1 SV=1
5	C1P636	630	1112	0.390	0.369	C1P636_CAEEL Ubiquitin-activating enzyme E1 C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uba-1 PE=1 SV=1
6	C8VMA9	734	1033	0.412	0.419	C8VMA9_EMENI E1 ubiquitin activating enzyme (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10266 PE=3 SV=1
7	O46111	730	1008	0.409	0.427	O46111_DROME E1 ubiquitin-activating enzyme OS=Drosophila melanogaster OX=7227 GN=Uba1 PE=2 SV=1
8	O94609	711	1012	0.394	0.410	UBA1_SCHPO Ubiquitin-activating enzyme E1 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ptr3 PE=1 SV=1
9	P22314	783	1058	0.414	0.412	UBA1_HUMAN Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3
10	P22515	737	1024	0.412	0.423	UBA1_YEAST Ubiquitin-activating enzyme E1 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBA1 PE=1 SV=2
11	P31254	769	1058	0.416	0.414	UBA1Y_MOUSE Ubiquitin-like modifier-activating enzyme 1 Y OS=Mus musculus OX=10090 GN=Uba1y PE=1 SV=2
12	P41226	559	1012	0.363	0.377	UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7 OS=Homo sapiens OX=9606 GN=UBA7 PE=1 SV=2
13	P92974	727	1077	0.381	0.372	UBE12_ARATH Ubiquitin-activating enzyme E1 2 OS=Arabidopsis thaliana OX=3702 GN=UBA2 PE=1 SV=1
14	P93028	685	1080	0.378	0.369	UBE11_ARATH Ubiquitin-activating enzyme E1 1 OS=Arabidopsis thaliana OX=3702 GN=UBA1 PE=1 SV=1
15	Q02053	782	1058	0.414	0.412	UBA1_MOUSE Ubiquitin-like modifier-activating enzyme 1 OS=Mus musculus OX=10090 GN=Uba1 PE=1 SV=1
16	Q27481	630	1113	0.390	0.368	Q27481_CAEEL Ubiquitin-activating enzyme E1 C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uba-1 PE=1 SV=1
17	Q3S1J5	629	1028	0.390	0.399	Q3S1J5_CAEEL Ubiquitin-activating enzyme E1 C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uba-1 PE=1 SV=1
18	Q55C16	759	1017	0.417	0.432	UBA1_DICDI Ubiquitin-like modifier-activating enzyme 1 OS=Dictyostelium discoideum OX=44689 GN=uba1 PE=3 SV=1
19	Q6P9P3	800	1058	0.427	0.424	Q6P9P3_DANRE Ubiquitin-like modifier-activating enzyme 1 OS=Danio rerio OX=7955 GN=wu:fb30f01 PE=1 SV=1
20	Q8C7R4	1976	1053	0.891	0.890	UBA6_MOUSE Ubiquitin-like modifier-activating enzyme 6 OS=Mus musculus OX=10090 GN=Uba6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16191 E1_4HB	4.9e-15	66.7	Ubiquitin-activating enzyme E1 four-helix bundle
2	PF16190 E1_FCCH	2.8e-22	89.9	Ubiquitin-activating enzyme E1 FCCH domain
3	PF09358 E1_UFD	5.2e-12	57.6	Ubiquitin fold domain
4	PF01488 Shikimate_DH	38	15.8	Shikimate / quinate 5-dehydrogenase
5	PF00899 ThiF	7e-95	327.9	ThiF family
6	PF10585 UBA_E1_SCCH	3.1e-77	271.5	Ubiquitin-activating enzyme, SCCH domain
7	PF17211 VHL_C	4.4e+02	12.1	VHL box domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313454

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354201	0.997	Ubiquitin-conjugating enzyme E2 Z
2	9606.ENSP00000381717	0.995	Ubiquitin-conjugating enzyme E2 D2
3	9606.ENSP00000263228	0.992	Ubiquitin-conjugating enzyme E2 R2
4	9606.ENSP00000261427	0.991	Ubiquitin-conjugating enzyme E2 K
5	9606.ENSP00000380178	0.987	Ubiquitin-conjugating enzyme E2 G1
6	9606.ENSP00000215574	0.984	Ubiquitin-conjugating enzyme E2 R1
7	9606.ENSP00000349722	0.983	Ubiquitin conjugating enzyme E2 D3
8	9606.ENSP00000363019	0.982	Ubiquitin-conjugating enzyme E2 D1
9	9606.ENSP00000360613	0.981	Ubiquitin-conjugating enzyme E2 A
10	9606.ENSP00000265339	0.980	Ubiquitin-conjugating enzyme E2 B
11	9606.ENSP00000366249	0.980	Ubiquitin D
12	9606.ENSP00000478474	0.980	NEDD8-conjugating enzyme UBE2F
13	9606.ENSP00000316176	0.979	Ubiquitin-conjugating enzyme E2 N
14	9606.ENSP00000338348	0.978	Ubiquitin-conjugating enzyme E2 G2
15	9606.ENSP00000253023	0.977	NEDD8-conjugating enzyme Ubc12
16	9606.ENSP00000222402	0.974	Ubiquitin-conjugating enzyme E2 D4
17	9606.ENSP00000348838	0.971	Ubiquitin-conjugating enzyme E2 C
18	9606.ENSP00000264552	0.969	Ubiquitin-conjugating enzyme E2 S
19	9606.ENSP00000346437	0.966	Ubiquitin-like modifier-activating enzyme ATG7
20	9606.ENSP00000272317	0.963	Ubiquitin-40S ribosomal protein S27a

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008641	0.999	ubiquitin-like modifier activating enzyme activity
GO:0004839	0.807	ubiquitin activating enzyme activity
GO:0019787	0.696	ubiquitin-like protein transferase activity
GO:0004842	0.608	ubiquitin-protein transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0036211	0.995	protein modification process
GO:0044248	0.994	cellular catabolic process
GO:0044260	0.990	cellular macromolecule metabolic process
GO:0032446	0.989	protein modification by small protein conjugation
GO:0006508	0.985	proteolysis
GO:0019941	0.978	modification-dependent protein catabolic process
GO:0016567	0.964	protein ubiquitination
GO:0006511	0.953	ubiquitin-dependent protein catabolic process
GO:0050789	0.410	regulation of biological process
GO:0050794	0.376	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005634	0.971	nucleus
GO:0070013	0.969	intracellular organelle lumen
GO:0031981	0.956	nuclear lumen
GO:0005654	0.953	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.2.-.-	0.999	Forming carbon-sulfur bonds.
EC:6.2.1.45	0.807	E1 ubiquitin-activating enzyme.
EC:2.-.-.-	0.696	Transferases.

[back to server]