StarFunc result for job id A0JLT2

User Input

>input (244 residues)
MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGA
GCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPG
SHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHK
QSRTQDPVPPETPSDSDHKKKKKKKEEDPDRKRKKKEKKKKKNRHSPDHPGMGSSQASSS
SSLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0JLT2	0.999	0.999	1.109E-39	244	1.000	1.000	A0JLT2.pdb.gz	MED19_HUMAN Mediator of RNA polymerase II transcription subunit 19 OS=Homo sapiens OX=9606 GN=MED19 PE=1 SV=2
2	PDB:8gxqs	0.288	0.635	5.601E-12	93	0.381	1.000	8gxqs.pdb.gz	Structures of +1 nucleosome-bound PIC-Mediator complex.
3	AFDB:Q9VVL6	0.382	0.285	3.258E-10	337	0.361	0.261	Q9VVL6.pdb.gz	MED19_DROME Mediator of RNA polymerase II transcription subunit 19 OS=Drosophila melanogaster OX=7227 GN=MED19 PE=1 SV=1
4	PDB:7nvrm	0.282	0.662	1.368E-9	84	0.344	1.000	7nvrm.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
5	PDB:5n9jC	0.328	0.632	7.468E-2	111	0.090	0.198	5n9jC.pdb.gz
6	AFDB:P49761	0.106	0.053	8.765E-1	638	0.168	0.064	P49761.pdb.gz	CLK3_HUMAN Dual specificity protein kinase CLK3 OS=Homo sapiens OX=9606 GN=CLK3 PE=1 SV=3
7	AFDB:P97868	0.089	0.027	1.885	1790	0.193	0.026	P97868.pdb.gz	RBBP6_MOUSE E3 ubiquitin-protein ligase RBBP6 OS=Mus musculus OX=10090 GN=Rbbp6 PE=1 SV=5
8	AFDB:P53958	0.092	0.068	2.861	396	0.131	0.081	P53958.pdb.gz	BOP3_YEAST Protein BOP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BOP3 PE=1 SV=1
9	AFDB:Q9VPM2	0.095	0.030	3.780	968	0.168	0.042	Q9VPM2.pdb.gz	Q9VPM2_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG17075 PE=4 SV=1
10	PDB:7wttu	0.071	0.036	4.860	642	0.061	0.023	7wttu.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
11	AFDB:A2RQR3	0.094	0.044	4.993	655	0.197	0.073	A2RQR3.pdb.gz	A2RQR3_DANRE Collagen alpha-1(X) chain precursor OS=Danio rerio OX=7955 GN=wu:fa66d11 PE=4 SV=1
12	PDB:6ww7E	0.061	0.117	5.210	101	0.033	0.079	6ww7E.pdb.gz	Structural basis for membrane insertion by the human ER membrane protein complex.
13	AFDB:A0A2R8PYI8	0.073	0.029	5.353	968	0.164	0.041	A0A2R8PYI8.pdb.gz	A0A2R8PYI8_DANRE Low density lipoprotein receptor-related protein 4 OS=Danio rerio OX=7955 GN=eni PE=4 SV=1
14	AFDB:A1A5S2	0.124	0.062	5.353	660	0.180	0.067	A1A5S2.pdb.gz	A1A5S2_RAT CXXC-type zinc finger protein 1 OS=Rattus norvegicus OX=10116 GN=Cxxc1 PE=2 SV=1
15	AFDB:H2KY58	0.114	0.052	5.353	748	0.197	0.064	H2KY58.pdb.gz	H2KY58_CAEEL ALG-1 OS=Caenorhabditis elegans OX=6239 GN=ain-2 PE=1 SV=1
16	PDB:3v7fB	0.081	0.086	5.586	220	0.041	0.045	3v7fB.pdb.gz	Crystal structure of Streptococcus pyogenes Csn2 reveals calcium-dependent conformational changes in its tertiary and quaternary structure
17	PDB:4v6wCE	0.064	0.068	7.910	228	0.053	0.057	4v6wCE.pdb.gz	Structures of the human and Drosophila 80S ribosome.
18	PDB:6jcxF	0.082	0.102	9.091	186	0.070	0.091	6jcxF.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.
19	PDB:7nacw	0.074	0.037	9.746	672	0.078	0.028	7nacw.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0JLT2	7.65e-176	484	244	1.000	1.000	MED19_HUMAN Mediator of RNA polymerase II transcription subunit 19 OS=Homo sapiens OX=9606 GN=MED19 PE=1 SV=2
2	Q8C1S0	3.28e-117	336	244	0.943	0.943	MED19_MOUSE Mediator of RNA polymerase II transcription subunit 19 OS=Mus musculus OX=10090 GN=Med19 PE=1 SV=1
3	Q9VVL6	4.53e-21	92.0	337	0.234	0.169	MED19_DROME Mediator of RNA polymerase II transcription subunit 19 OS=Drosophila melanogaster OX=7227 GN=MED19 PE=1 SV=1
4	Q9XXV8	5.4	30.8	858	0.070	0.020	MYOK_DICDI Myosin-K heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoK PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10278 Med19	2.1e-80	280.3	Mediator of RNA pol II transcription subunit 19

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000006332

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000001091	0.972	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
2	9598.ENSPTRP00000028675	0.969	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
3	9598.ENSPTRP00000000752	0.968	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
4	9598.ENSPTRP00000007186	0.968	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
5	9598.ENSPTRP00000018177	0.968	Uncharacterized protein
6	9598.ENSPTRP00000037414	0.968	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
7	9598.ENSPTRP00000009971	0.966	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
8	9598.ENSPTRP00000014753	0.963	Mediator of RNA polymerase II transcription subunit 31
9	9598.ENSPTRP00000029827	0.956	Mediator of RNA polymerase II transcription subunit 7
10	9598.ENSPTRP00000039482	0.956	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
11	9598.ENSPTRP00000044774	0.956	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
12	9598.ENSPTRP00000057287	0.956	Mediator of RNA polymerase II transcription subunit 13
13	9598.ENSPTRP00000018799	0.955	Mediator complex subunit 29
14	9598.ENSPTRP00000011011	0.954	Mediator of RNA polymerase II transcription subunit 6
15	9598.ENSPTRP00000035106	0.950	Mediator complex subunit 30
16	9598.ENSPTRP00000047374	0.950	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. This subunit may specifically regulate transcription of targets of the Wnt signa [...]
17	9598.ENSPTRP00000015490	0.949	Mediator of RNA polymerase II transcription subunit 1
18	9598.ENSPTRP00000040926	0.943	Mediator complex subunit 22
19	9598.ENSPTRP00000014688	0.937	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors
20	9598.ENSPTRP00000015055	0.937	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0051171	0.976	regulation of nitrogen compound metabolic process
GO:0080090	0.975	regulation of primary metabolic process
GO:0006355	0.965	regulation of DNA-templated transcription
GO:0006357	0.962	regulation of transcription by RNA polymerase II
GO:0009987	0.956	cellular process
GO:0045893	0.956	positive regulation of DNA-templated transcription
GO:0008152	0.900	metabolic process
GO:0045944	0.894	positive regulation of transcription by RNA polymerase II
GO:0071704	0.881	organic substance metabolic process
GO:0006807	0.804	nitrogen compound metabolic process
GO:0044238	0.788	primary metabolic process
GO:0044237	0.784	cellular metabolic process
GO:0043170	0.753	macromolecule metabolic process
GO:1901360	0.656	organic cyclic compound metabolic process
GO:0034641	0.636	cellular nitrogen compound metabolic process
GO:0090304	0.633	nucleic acid metabolic process
GO:0016070	0.351	RNA metabolic process
GO:0010467	0.315	gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0140513	1.000	nuclear protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0090575	0.950	RNA polymerase II transcription regulator complex
GO:0016592	0.939	mediator complex
GO:0070847	0.929	core mediator complex
GO:1902494	0.385	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]