StarFunc result for job id A0JNW5

User Input

>input (1464 residues)
MAGIIKKQILKHLSRFTKNLSPDKINLSTLKGEGELKNLELDEEVLQNMLDLPTWLAINK
VFCNKASIRIPWTKLKTHPICLSLDKVIMEMSTCEEPRSPNGPSPIATASGQSEYGFAEK
VVEGISVSVNSIVIRIGAKAFNASFELSQLRIYSVNAHWEHGDLRFTRIQDPQRGEVLTF
KEINWQMIRIEADATQSSHLEIMCAPVRLITNQSKIRVTLKRRLKDCNVIATKLVLILDD
LLWVLTDSQLKAMVQYAKSLSEAIEKSTEQRKSMAPEPTQSSTVVASAQQVKTTQTSNAP
DVNDAIVKLFNDFDVKETSHHLVISHLDLHICDDIHAKEKESNRRITGGAMQLSFTQLTI
DYYPYHKAGDSCNHWMYFSDATKTKNGWANELLHEFECNVEMLKQAVKDHNVGSPPKSPT
HASPQHTQTEKDYPLKGTCRTPSVLSQQSKAKLMSSSVVVRLADFNIYQVSTAEQCRSSP
KSMICCNKKSLYLPQEMSAVYIEFTEYYYPDGKDFPIPSPNLYSQLNALQFTVDERSILW
LNQFLLDLKQSLNQFMAVYKLNDNSKSDEHVDVRVDGLMLKFVIPSEVKSECHQDQPRAI
SIQSSEMIATNTRHCPNCRHSDLEALFQDFKDCDFFSKTYTSFPKSCDNFNLLHPIFQRH
AHEQDTKMHEIYKGNITPQLNKNTLKTSAATDVWAVYFSQFWIDYEGMKSGKGRPISFVD
SFPLSIWICQPTRYAESQKEPQTCNQVSLNTSQSESSDLAGRLKRKKLLKEYYSTESEPL
TNGGQKPSSSDTFFRFSPSSSEADIHLLVHVHKHVSMQINHYQYLLLLFLHESLILLSEN
LRKDVEAVTGSPASQTSICIGILLRSAELALLLHPVDQANTLKSPVSESVSPVVPDYLPT
ENGDFLSSKRKQISRDINRIRSVTVNHMSDNRSMSVDLSHIPLKDPLLFKSASDTNLQKG
ISFMDYLSDKHLGKISEDESSGLVYKSGSGEIGSETSDKKDSFYTDSSSILNYREDSNIL
SFDSDGNQNILSSTLTSKGNETIESIFKAEDLLPEAASLSENLDISKEETPPVRTLKSQS
SLSGKPKERCPPNLAPLCVSYKNMKRSSSQMSLDTISLDSMILEEQLLESDGSDSHMFLE
KGNKKNSTTNYRGTAESVNAGANLQNYGETSPDAISTNSEGAQENHDDLMSVVVFKITGV
NGEIDIRGEDTEICLQVNQVTPDQLGNISLRHYLCNRPVGSDQKAVIHSKSSPEISLRFE
SGPGAVIHSLLAEKNGFLQCHIENFSTEFLTSSLMNIQHFLEDETVATVMPMKIQVSNTK
INLKDDSPRSSTVSLEPAPVTVHIDHLVVERSDDGSFHIRDSHMLNTGNDLKENVKSDSV
LLTSGKYDLKKQRSVTQATQTSPGVPWPSQSANFPEFSFDFTREQLMEENESLKQELAKA
KMALAEAHLEKDALLHHIKKMTVE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0JNW5	1.000	1.000	0.000	1464	1.000	1.000	A0JNW5.pdb.gz	BLT3B_HUMAN Bridge-like lipid transfer protein family member 3B OS=Homo sapiens OX=9606 GN=BLTP3B PE=1 SV=2
2	AFDB:Q6BDS2	0.680	0.691	0.000	1440	0.420	0.427	Q6BDS2.pdb.gz	BLT3A_HUMAN Bridge-like lipid transfer protein family member 3A OS=Homo sapiens OX=9606 GN=BLTP3A PE=1 SV=1
3	PDB:6a9eA	0.078	0.302	7.913E-6	339	0.018	0.080	6a9eA.pdb.gz
4	PDB:5cskB	0.056	0.046	1.009E-3	2017	0.035	0.025	5cskB.pdb.gz
5	PDB:6g2iA	0.060	0.048	1.325E-3	2080	0.041	0.029	6g2iA.pdb.gz
6	PDB:5cslB	0.052	0.042	2.049E-3	2072	0.033	0.024	5cslB.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
7	PDB:5cskA	0.049	0.039	2.285E-3	1996	0.027	0.020	5cskA.pdb.gz
8	PDB:6g2dC	0.056	0.046	5.173E-3	2121	0.032	0.022	6g2dC.pdb.gz
9	PDB:5cslA	0.052	0.042	9.419E-3	2050	0.033	0.024	5cslA.pdb.gz	Crystal structure of the 500-kDa yeast acetyl-CoA carboxylase holoenzyme dimer.
10	PDB:7n9sA	0.032	0.023	9.419E-3	2365	0.016	0.010	7n9sA.pdb.gz
11	PDB:6ofrA	0.054	0.089	1.912E-2	758	0.025	0.049	6ofrA.pdb.gz	Protease-associated import systems are widespread in Gram-negative bacteria.
12	PDB:3h4zA	0.051	0.098	7.070E-2	568	0.010	0.026	3h4zA.pdb.gz	The structure of the dust mite allergen Der p 7 reveals similarities to innate immune proteins.
13	AFDB:Q52KB6	0.040	0.030	1.624E-1	2323	0.111	0.070	Q52KB6.pdb.gz	C2CD3_MOUSE C2 domain-containing protein 3 OS=Mus musculus OX=10090 GN=C2cd3 PE=1 SV=3
14	AFDB:P08553	0.027	0.039	2.379E-1	848	0.038	0.066	P08553.pdb.gz	NFM_MOUSE Neurofilament medium polypeptide OS=Mus musculus OX=10090 GN=Nefm PE=1 SV=4
15	AFDB:Q9N4G4	0.039	0.038	6.005E-1	1475	0.074	0.073	Q9N4G4.pdb.gz	MED1_CAEEL Mediator of RNA polymerase II transcription subunit 1.1 OS=Caenorhabditis elegans OX=6239 GN=sop-3 PE=1 SV=2
16	AFDB:B2RY69	0.034	0.036	6.341E-1	1237	0.048	0.057	B2RY69.pdb.gz	B2RY69_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
17	AFDB:P59808	0.027	0.032	8.793E-1	1230	0.068	0.081	P59808.pdb.gz	SASH1_MOUSE SAM and SH3 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sash1 PE=1 SV=1
18	AFDB:Q54PV1	0.053	0.046	8.793E-1	1800	0.114	0.093	Q54PV1.pdb.gz	Q54PV1_DICDI Inositol 5-phosphatase OS=Dictyostelium discoideum OX=44689 GN=Dd5P2 PE=4 SV=1
19	AFDB:A2VDJ0	0.052	0.050	1.516	1609	0.104	0.094	A2VDJ0.pdb.gz	T131L_HUMAN Transmembrane protein 131-like OS=Homo sapiens OX=9606 GN=TMEM131L PE=1 SV=2
20	AFDB:O94885	0.026	0.030	1.516	1247	0.064	0.075	O94885.pdb.gz	SASH1_HUMAN SAM and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SASH1 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0JNW5	0.0	3040	1464	1.000	1.000	BLT3B_HUMAN Bridge-like lipid transfer protein family member 3B OS=Homo sapiens OX=9606 GN=BLTP3B PE=1 SV=2
2	Q6BDS2	0.0	1027	1440	0.431	0.438	BLT3A_HUMAN Bridge-like lipid transfer protein family member 3A OS=Homo sapiens OX=9606 GN=BLTP3A PE=1 SV=1
3	Q54KX3	1.96e-06	55.5	4246	0.020	0.007	VP13F_DICDI Intermembrane lipid transfer protein vps13F OS=Dictyostelium discoideum OX=44689 GN=vps13F PE=3 SV=1
4	F4JNE2	5.41e-06	53.9	4219	0.016	0.005	F4JNE2_ARATH Pleckstrin homology (PH) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=DL4605C PE=1 SV=1
5	F4KIH9	1.05e-05	53.1	3464	0.019	0.008	F4KIH9_ARATH Vacuolar protein sorting-associated protein, putative (DUF1162) OS=Arabidopsis thaliana OX=3702 GN=SHBY PE=1 SV=1
6	Q9FT44	1.05e-05	53.1	3306	0.019	0.008	Q9FT44_ARATH VPS13-like protein OS=Arabidopsis thaliana OX=3702 GN=At5g24740 PE=3 SV=1
7	Q80TY5	9.72e-05	49.7	3993	0.018	0.007	VP13B_MOUSE Intermembrane lipid transfer protein VPS13B OS=Mus musculus OX=10090 GN=Vps13b PE=1 SV=3
8	Q7Z7G8	1.15e-04	49.7	4022	0.016	0.006	VP13B_HUMAN Intermembrane lipid transfer protein VPS13B OS=Homo sapiens OX=9606 GN=VPS13B PE=1 SV=2
9	F4HWS2	1.23e-04	49.3	4146	0.017	0.006	F4HWS2_ARATH Calcium-dependent lipid-binding family protein OS=Arabidopsis thaliana OX=3702 GN=At1g48090 PE=1 SV=1
10	Q55FG3	8.13e-04	46.6	3848	0.018	0.007	VP13C_DICDI Intermembrane lipid transfer protein tipC OS=Dictyostelium discoideum OX=44689 GN=tipC PE=3 SV=1
11	Q5THJ4	0.004	44.7	4388	0.016	0.005	VP13D_HUMAN Intermembrane lipid transfer protein VPS13D OS=Homo sapiens OX=9606 GN=VPS13D PE=1 SV=2
12	A1Z713	0.016	42.4	3321	0.026	0.011	VPS13_DROME Intermembrane lipid transfer protein Vps13 OS=Drosophila melanogaster OX=7227 GN=Vps13 PE=1 SV=2
13	G0S3B8	0.11	39.7	3225	0.015	0.007	VPS13_CHATD Intermembrane lipid transfer protein VPS13 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=VPS13 PE=1 SV=1
14	Q5H8C4	0.12	39.7	3166	0.015	0.007	VP13A_MOUSE Intermembrane lipid transfer protein VPS13A OS=Mus musculus OX=10090 GN=Vps13a PE=1 SV=1
15	Q9VU08	0.17	39.3	3919	0.013	0.005	VP13D_DROME Intermembrane lipid transfer protein Vps13D OS=Drosophila melanogaster OX=7227 GN=Vps13D PE=1 SV=3
16	Q96RL7	0.82	37.0	3174	0.014	0.007	VP13A_HUMAN Intermembrane lipid transfer protein VPS13A OS=Homo sapiens OX=9606 GN=VPS13A PE=1 SV=2
17	Q95ZV7	1.4	35.8	797	0.022	0.040	DDRB_CAEEL Discoidin domain-containing receptor tyrosine kinase B OS=Caenorhabditis elegans OX=6239 GN=ddr-2 PE=1 SV=1
18	P87319	1.7	35.8	3011	0.013	0.006	VP13A_SCHPO Intermembrane lipid transfer protein vps1301 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps1301 PE=3 SV=2
19	Q8BX70	3.3	35.0	3748	0.013	0.005	VP13C_MOUSE Intermembrane lipid transfer protein VPS13C OS=Mus musculus OX=10090 GN=Vps13c PE=1 SV=2
20	Q21480	3.4	34.7	2290	0.015	0.010	ATG2_CAEEL Autophagy-related protein 2 OS=Caenorhabditis elegans OX=6239 GN=atg-2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12624 Chorein_N	5.7e-16	70.0	N-terminal region of Chorein or VPS13
2	PF16908 VPS13	2.2e+02	12.9	Vacuolar sorting-associated protein 13, N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000279907

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253047	0.676	Transmembrane protein 160
2	9606.ENSP00000261530	0.639	G patch domain-containing protein 2-like
3	9606.ENSP00000289788	0.633	Zinc finger and SCAN domain-containing protein 23
4	9606.ENSP00000342889	0.586	DNA-directed RNA polymerases I, II, and III subunit RPABC4
5	9606.ENSP00000382508	0.571	Cell death-inducing p53-target protein 1
6	9606.ENSP00000258301	0.560	Syntaxin-6
7	9606.ENSP00000365528	0.555	Receptor-type tyrosine-protein phosphatase H
8	9606.ENSP00000355902	0.553	G patch domain-containing protein 2
9	9606.ENSP00000384651	0.553	Myotubularin-related protein 3
10	9606.ENSP00000409279	0.545	OTU domain-containing protein 4
11	9606.ENSP00000428876	0.528	Protein FAM83A
12	9606.ENSP00000261517	0.516	Vacuolar protein sorting-associated protein 13C
13	9606.ENSP00000302867	0.512	Olfactory receptor 7G3
14	9606.ENSP00000396234	0.504	DEP domain containing 4
15	9606.ENSP00000432786	0.502	Lysine-specific demethylase 2A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0120013	1.000	lipid transfer activity
GO:0062069	1.000	GARP complex binding
GO:0042803	1.000	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0051179	0.928	localization
GO:0016482	0.919	cytosolic transport
GO:0016192	0.910	vesicle-mediated transport
GO:0071840	0.909	cellular component organization or biogenesis
GO:0016043	0.896	cellular component organization
GO:0016197	0.895	endosomal transport
GO:0010876	0.866	lipid localization
GO:0061024	0.801	membrane organization
GO:0006869	0.747	lipid transport
GO:0042147	0.744	retrograde transport, endosome to Golgi
GO:0050789	0.658	regulation of biological process
GO:0048193	0.635	Golgi vesicle transport
GO:0050794	0.614	regulation of cellular process
GO:0008152	0.439	metabolic process
GO:0071704	0.317	organic substance metabolic process
GO:0044237	0.315	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005768	1.000	endosome
GO:0005829	0.999	cytosol
GO:0005769	0.984	early endosome
GO:0016020	0.882	membrane
GO:0031090	0.300	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]