StarFunc result for job id A0PJK1

User Input

>input (596 residues)
MAANSTSDLHTPGTQLSVADIIVITVYFALNVAVGIWSSCRASRNTVNGYFLAGRDMTWW
PIGASLFASSEGSGLFIGLAGSGAAGGLAVAGFEWNATYVLLALAWVFVPIYISSEIVTL
PEYIQKRYGGQRIRMYLSVLSLLLSVFTKISLDLYAGALFVHICLGWNFYLSTILTLGIT
ALYTIAGGLAAVIYTDALQTLIMVVGAVILTIKAFDQIGGYGQLEAAYAQAIPSRTIANT
TCHLPRTDAMHMFRDPHTGDLPWTGMTFGLTIMATWYWCTDQVIVQRSLSARDLNHAKAG
SILASYLKMLPMGLIIMPGMISRALFPDDVGCVVPSECLRACGAEVGCSNIAYPKLVMEL
MPIGLRGLMIAVMLAALMSSLTSIFNSSSTLFTMDIWRRLRPRSGERELLLVGRLVIVAL
IGVSVAWIPVLQDSNSGQLFIYMQSVTSSLAPPVTAVFVLGVFWRRANEQGAFWGLIAGL
VVGATRLVLEFLNPAPPCGEPDTRPAVLGSIHYLHFAVALFALSGAVVVAGSLLTPPPQS
VQIENLTWWTLAQDVPLGTKAGDGQTPQKHAFWARVCGFNAILLMCVNIFFYAYFA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0PJK1	1.000	1.000	3.689E-88	596	1.000	1.000	A0PJK1.pdb.gz	SC5AA_HUMAN Sodium/mannose cotransporter SLC5A10 OS=Homo sapiens OX=9606 GN=SLC5A10 PE=1 SV=2
2	AFDB:Q5SWY8	0.994	0.994	6.243E-80	596	0.884	0.884	Q5SWY8.pdb.gz	SC5AA_MOUSE Sodium/mannose cotransporter SLC5A10 OS=Mus musculus OX=10090 GN=Slc5a10 PE=1 SV=1
3	AFDB:Q2M3M2	0.940	0.824	4.205E-62	681	0.621	0.543	Q2M3M2.pdb.gz	SC5A9_HUMAN Sodium/glucose cotransporter 4 OS=Homo sapiens OX=9606 GN=SLC5A9 PE=1 SV=2
4	AFDB:Q8K0E3	0.941	0.834	2.162E-56	673	0.534	0.473	Q8K0E3.pdb.gz	SC5AB_MOUSE Sodium/myo-inositol cotransporter 2 OS=Mus musculus OX=10090 GN=Slc5a11 PE=1 SV=1
5	AFDB:Q8WWX8	0.944	0.834	3.332E-56	675	0.523	0.462	Q8WWX8.pdb.gz	SC5AB_HUMAN Sodium/myo-inositol cotransporter 2 OS=Homo sapiens OX=9606 GN=SLC5A11 PE=1 SV=1
6	AFDB:P13866	0.927	0.833	5.848E-56	664	0.549	0.492	P13866.pdb.gz	SC5A1_HUMAN Sodium/glucose cotransporter 1 OS=Homo sapiens OX=9606 GN=SLC5A1 PE=1 SV=1
7	AFDB:P53790	0.931	0.835	6.658E-56	665	0.550	0.493	P53790.pdb.gz	SC5A1_RAT Sodium/glucose cotransporter 1 OS=Rattus norvegicus OX=10116 GN=Slc5a1 PE=2 SV=1
8	AFDB:P11170	0.934	0.841	8.631E-56	662	0.547	0.492	P11170.pdb.gz	SC5A1_RABIT Sodium/glucose cotransporter 1 OS=Oryctolagus cuniculus OX=9986 GN=SLC5A1 PE=1 SV=1
9	AFDB:P31639	0.935	0.831	4.277E-55	672	0.557	0.494	P31639.pdb.gz	SC5A2_HUMAN Sodium/glucose cotransporter 2 OS=Homo sapiens OX=9606 GN=SLC5A2 PE=1 SV=1
10	AFDB:Q9NY91	0.934	0.845	7.837E-55	659	0.493	0.446	Q9NY91.pdb.gz	SC5A4_HUMAN Probable glucose sensor protein SLC5A4 OS=Homo sapiens OX=9606 GN=SLC5A4 PE=1 SV=1
11	PDB:7wmvA	0.917	0.908	1.695E-52	602	0.539	0.533	7wmvA.pdb.gz	Structural mechanism of SGLT1 inhibitors.
12	PDB:7vsiA	0.922	0.937	5.449E-52	586	0.549	0.558	7vsiA.pdb.gz	Structural basis of inhibition of the human SGLT2-MAP17 glucose transporter.
13	PDB:7slaA	0.872	0.888	1.402E-46	585	0.579	0.590	7slaA.pdb.gz	Structure and mechanism of the SGLT family of glucose transporters.
14	PDB:7sl9A	0.712	0.844	3.237E-17	497	0.190	0.227	7sl9A.pdb.gz	Structure and mechanism of the SGLT family of glucose transporters.
15	PDB:5j4nA	0.436	0.562	3.416E-5	437	0.092	0.126	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
16	PDB:7cmhB	0.366	0.448	6.259E-5	458	0.122	0.159	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
17	PDB:7s1xB	0.379	0.278	6.259E-5	871	0.109	0.075	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
18	PDB:6vrhA	0.343	0.368	2.724E-4	541	0.114	0.126	6vrhA.pdb.gz	Chemical and structural investigation of the paroxetine-human serotonin transporter complex.
19	PDB:7dskB	0.414	0.510	3.532E-4	464	0.099	0.127	7dskB.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
20	PDB:3lrbA	0.386	0.524	4.781E-4	410	0.114	0.166	3lrbA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0PJK1	1205	596	1.000	1.000	SC5AA_HUMAN Sodium/mannose cotransporter SLC5A10 OS=Homo sapiens OX=9606 GN=SLC5A10 PE=1 SV=2
2	A0PJT9	600	659	0.498	0.451	A0PJT9_MOUSE Slc5a4b protein OS=Mus musculus OX=10090 GN=Slc5a4b PE=2 SV=1
3	D3ZIS0	593	671	0.475	0.422	SC5A4_RAT Solute carrier family 5 member 4 OS=Rattus norvegicus OX=10116 GN=Slc5a4 PE=3 SV=1
4	P11170	633	662	0.547	0.492	SC5A1_RABIT Sodium/glucose cotransporter 1 OS=Oryctolagus cuniculus OX=9986 GN=SLC5A1 PE=1 SV=1
5	P13866	634	664	0.547	0.491	SC5A1_HUMAN Sodium/glucose cotransporter 1 OS=Homo sapiens OX=9606 GN=SLC5A1 PE=1 SV=1
6	P31637	598	718	0.470	0.390	SC5A3_CANLF Sodium/myo-inositol cotransporter OS=Canis lupus familiaris OX=9615 GN=SLC5A3 PE=1 SV=1
7	P31639	620	672	0.529	0.469	SC5A2_HUMAN Sodium/glucose cotransporter 2 OS=Homo sapiens OX=9606 GN=SLC5A2 PE=1 SV=1
8	P53790	610	665	0.542	0.486	SC5A1_RAT Sodium/glucose cotransporter 1 OS=Rattus norvegicus OX=10116 GN=Slc5a1 PE=2 SV=1
9	P53792	635	670	0.564	0.501	SC5A2_RAT Sodium/glucose cotransporter 2 OS=Rattus norvegicus OX=10116 GN=Slc5a2 PE=1 SV=1
10	P53794	593	718	0.465	0.386	SC5A3_HUMAN Sodium/myo-inositol cotransporter OS=Homo sapiens OX=9606 GN=SLC5A3 PE=1 SV=3
11	Q2M3M2	691	681	0.596	0.521	SC5A9_HUMAN Sodium/glucose cotransporter 4 OS=Homo sapiens OX=9606 GN=SLC5A9 PE=1 SV=2
12	Q2VPB3	599	657	0.498	0.452	Q2VPB3_MOUSE Slc5a4b protein (Fragment) OS=Mus musculus OX=10090 GN=Slc5a4b PE=2 SV=1
13	Q3UNC8	599	660	0.498	0.450	Q3UNC8_MOUSE Solute carrier family 5 member 4 OS=Mus musculus OX=10090 GN=Slc5a4b PE=2 SV=1
14	Q5SWY8	1051	596	0.886	0.886	SC5AA_MOUSE Sodium/mannose cotransporter SLC5A10 OS=Mus musculus OX=10090 GN=Slc5a10 PE=1 SV=1
15	Q80WA5	601	718	0.477	0.396	Q80WA5_RAT Sodium myo-inositol transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc5a3 PE=2 SV=1
16	Q8C3K6	608	665	0.535	0.480	SC5A1_MOUSE Sodium/glucose cotransporter 1 OS=Mus musculus OX=10090 GN=Slc5a1 PE=1 SV=1
17	Q8K0E3	625	673	0.513	0.455	SC5AB_MOUSE Sodium/myo-inositol cotransporter 2 OS=Mus musculus OX=10090 GN=Slc5a11 PE=1 SV=1
18	Q8WWX8	613	675	0.503	0.444	SC5AB_HUMAN Sodium/myo-inositol cotransporter 2 OS=Homo sapiens OX=9606 GN=SLC5A11 PE=1 SV=1
19	Q91ZP4	600	660	0.498	0.450	S5A4B_MOUSE Solute carrier family 5 member 4B OS=Mus musculus OX=10090 GN=Slc5a4b PE=2 SV=2
20	Q923I7	637	670	0.562	0.500	SC5A2_MOUSE Sodium/glucose cotransporter 2 OS=Mus musculus OX=10090 GN=Slc5a2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00474 SSF	3e-135	462.8	Sodium:solute symporter family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379008

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352216	0.731	Solute carrier family 2, facilitated glucose transporter member 10
2	9606.ENSP00000373647	0.709	Protein FAM83G
3	9606.ENSP00000323568	0.662	Solute carrier family 2, facilitated glucose transporter member 2
4	9606.ENSP00000365686	0.611	Solute carrier family 15 member 1
5	9606.ENSP00000366641	0.595	Solute carrier family 2, facilitated glucose transporter member 5
6	9606.ENSP00000262352	0.543	Excitatory amino acid transporter 3
7	9606.ENSP00000309430	0.527	GPI transamidase component PIG-S
8	9606.ENSP00000308591	0.506	Galactose-3-O-sulfotransferase 3
9	9606.ENSP00000357840	0.501	Sodium-dependent glucose transporter 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005353	1.000	fructose transmembrane transporter activity
GO:0005402	1.000	carbohydrate:monoatomic cation symporter activity
GO:0015370	1.000	solute:sodium symporter activity
GO:0015578	0.993	mannose transmembrane transporter activity
GO:0005488	0.897	binding
GO:0005355	0.893	glucose transmembrane transporter activity
GO:0005515	0.869	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008643	0.997	carbohydrate transport
GO:0055085	0.996	transmembrane transport
GO:0015749	0.989	monosaccharide transmembrane transport
GO:0008645	0.966	hexose transmembrane transport
GO:1904659	0.314	glucose transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.996	organelle
GO:0043227	0.994	membrane-bounded organelle
GO:0005576	0.983	extracellular region
GO:1903561	0.969	extracellular vesicle
GO:0005615	0.952	extracellular space
GO:0070062	0.892	extracellular exosome
GO:0005622	0.698	intracellular anatomical structure
GO:0043229	0.650	intracellular organelle
GO:0005737	0.590	cytoplasm
GO:0043231	0.313	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]