StarFunc result for job id A0PJX2

User Input

>input (215 residues)
MRGLRWRYTRLPSQVEDTLSGEEGNEEEEEEEAAPDPAAAPEDPTVPQLTEASQVLSASE
IRQLSFHFPPRVTGHPWSLVFCTSRDGFSLQSLYRRMEGCSGPVLLVLRDQDGQIFGAFS
SSAIRLSKGFYGTGETFLFSFSPQLKVFKWTGSNSFFVKGDLDSLMMGSGSGRFGLWLDG
DLFRGGSSPCPTFNNEVLARQEQFCIQELEAWLLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2ACG1	0.815	0.884	1.445E-36	198	0.800	0.869	A2ACG1.pdb.gz	TLDC2_MOUSE TLD domain-containing protein 2 OS=Mus musculus OX=10090 GN=Tldc2 PE=3 SV=1
2	AFDB:Q8NI08	0.791	0.185	5.041E-27	942	0.391	0.089	Q8NI08.pdb.gz	NCOA7_HUMAN Nuclear receptor coactivator 7 OS=Homo sapiens OX=9606 GN=NCOA7 PE=1 SV=2
3	AFDB:Q7KTR8	0.800	0.646	5.334E-27	267	0.409	0.330	Q7KTR8.pdb.gz	Q7KTR8_DROME L82D OS=Drosophila melanogaster OX=7227 GN=mtd PE=2 SV=1
4	AFDB:Q4V8B0	0.795	0.208	5.079E-26	839	0.428	0.110	Q4V8B0.pdb.gz	OXR1_RAT Oxidation resistance protein 1 OS=Rattus norvegicus OX=10116 GN=Oxr1 PE=1 SV=3
5	AFDB:A4V2F2	0.800	0.140	6.014E-26	1246	0.409	0.071	A4V2F2.pdb.gz	A4V2F2_DROME Mustard, isoform U OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
6	AFDB:Q4KMM3	0.795	0.204	6.731E-26	866	0.423	0.105	Q4KMM3.pdb.gz	OXR1_MOUSE Oxidation resistance protein 1 OS=Mus musculus OX=10090 GN=Oxr1 PE=1 SV=3
7	AFDB:Q6DFV7	0.790	0.182	6.731E-26	943	0.419	0.095	Q6DFV7.pdb.gz	NCOA7_MOUSE Nuclear receptor coactivator 7 OS=Mus musculus OX=10090 GN=Ncoa7 PE=1 SV=2
8	AFDB:Q8IPN9	0.803	0.166	7.534E-26	1055	0.381	0.078	Q8IPN9.pdb.gz	Q8IPN9_DROME Mustard, isoform K OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
9	AFDB:A0A0B4K699	0.800	0.151	1.118E-25	1158	0.381	0.071	A0A0B4K699.pdb.gz	A0A0B4K699_DROME Mustard, isoform Y OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
10	AFDB:Q8N573	0.795	0.199	1.481E-25	874	0.419	0.103	Q8N573.pdb.gz	OXR1_HUMAN Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1 PE=1 SV=2
11	PDB:7fdeP	0.721	0.849	4.967E-15	181	0.247	0.293	7fdeP.pdb.gz
12	PDB:7uneU	0.722	0.373	4.967E-15	427	0.242	0.122	7uneU.pdb.gz
13	PDB:1zxuA	0.120	0.144	1.203E-1	162	0.070	0.093	1zxuA.pdb.gz
14	PDB:5khrA	0.146	0.038	2.647E-1	1391	0.093	0.014	5khrA.pdb.gz
15	PDB:7v2wH	0.132	0.088	2.647E-1	379	0.079	0.045	7v2wH.pdb.gz
16	PDB:6e20B	0.184	0.268	3.316E-1	133	0.051	0.083	6e20B.pdb.gz	Structure of the zebrafish galectin-1-L2 and model of its interaction with the infectious hematopoietic necrosis virus (IHNV) envelope glycoprotein.
17	PDB:1jc9A	0.205	0.204	3.926E-1	220	0.074	0.073	1jc9A.pdb.gz	The 2.0-A crystal structure of tachylectin 5A provides evidence for the common origin of the innate immunity and the blood coagulation systems.
18	PDB:6bk8D	0.105	0.075	4.154E-1	359	0.060	0.036	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
19	PDB:3k2iA	0.114	0.068	4.919E-1	405	0.084	0.044	3k2iA.pdb.gz
20	PDB:5tthA	0.103	0.042	5.204E-1	671	0.065	0.021	5tthA.pdb.gz	Symmetry broken and rebroken during the ATP hydrolysis cycle of the mitochondrial Hsp90 TRAP1.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2ACG1	2.02e-110	316	198	0.707	0.768	TLDC2_MOUSE TLD domain-containing protein 2 OS=Mus musculus OX=10090 GN=Tldc2 PE=3 SV=1
2	Q4V8B0	1.29e-59	202	839	0.428	0.110	OXR1_RAT Oxidation resistance protein 1 OS=Rattus norvegicus OX=10116 GN=Oxr1 PE=1 SV=3
3	Q4KMM3	1.63e-59	202	866	0.428	0.106	OXR1_MOUSE Oxidation resistance protein 1 OS=Mus musculus OX=10090 GN=Oxr1 PE=1 SV=3
4	Q8N573	1.89e-59	202	874	0.409	0.101	OXR1_HUMAN Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1 PE=1 SV=2
5	Q8IPN7	3.72e-58	184	213	0.381	0.385	Q8IPN7_DROME L82E OS=Drosophila melanogaster OX=7227 GN=mtd PE=2 SV=1
6	Q8IPN6	5.93e-58	183	192	0.381	0.427	Q8IPN6_DROME L82G OS=Drosophila melanogaster OX=7227 GN=mtd PE=2 SV=1
7	Q7KTR7	7.18e-58	183	210	0.381	0.390	Q7KTR7_DROME L82F OS=Drosophila melanogaster OX=7227 GN=mtd PE=2 SV=1
8	Q7KTR8	5.22e-57	183	267	0.381	0.307	Q7KTR8_DROME L82D OS=Drosophila melanogaster OX=7227 GN=mtd PE=2 SV=1
9	B7Z0T6	7.68e-54	186	789	0.377	0.103	B7Z0T6_DROME Mustard, isoform R OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
10	Q8IPN9	1.35e-53	186	1055	0.377	0.077	Q8IPN9_DROME Mustard, isoform K OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
11	Q8IPN8	1.48e-53	185	869	0.377	0.093	Q8IPN8_DROME L82C OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
12	A0A0B4KF88	1.55e-53	185	871	0.377	0.093	A0A0B4KF88_DROME Mustard, isoform AA OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
13	A0A0B4K620	1.57e-53	186	1344	0.377	0.060	A0A0B4K620_DROME Mustard, isoform V OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
14	Q9VNA1	1.92e-53	186	1270	0.377	0.064	Q9VNA1_DROME L82A OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=2
15	Q7KNC5	1.95e-53	186	1025	0.377	0.079	Q7KNC5_DROME L82B OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
16	Q0KIB9	1.97e-53	186	1314	0.377	0.062	Q0KIB9_DROME Mustard, isoform P OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
17	A0A0B4K699	2.01e-53	186	1158	0.377	0.070	A0A0B4K699_DROME Mustard, isoform Y OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
18	A4V2F2	2.07e-53	186	1246	0.377	0.065	A4V2F2_DROME Mustard, isoform U OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
19	Q9VNA2	2.08e-53	186	1127	0.377	0.072	Q9VNA2_DROME Mustard, isoform X OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=3
20	Q8MSQ5	2.13e-53	186	1033	0.377	0.078	Q8MSQ5_DROME Mustard, isoform G OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07534 TLD	7e-34	128.5	TLD

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000217320

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386456	0.652	AP2-associated protein kinase 1
2	9606.ENSP00000322724	0.609	Olfactory receptor 51H1
3	9606.ENSP00000344101	0.561	Olfactory receptor 6N2
4	9606.ENSP00000307598	0.556	Olfactory receptor 9K2
5	9606.ENSP00000332886	0.531	FRAS1-related extracellular matrix protein 3
6	9606.ENSP00000452277	0.519	Olfactory receptor 4C13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.950	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0080134	0.942	regulation of response to stress
GO:1901215	0.777	negative regulation of neuron death
GO:1902882	0.757	regulation of response to oxidative stress
GO:1903202	0.749	negative regulation of oxidative stress-induced cell death
GO:1903203	0.621	regulation of oxidative stress-induced neuron death
GO:0048518	0.514	positive regulation of biological process
GO:0009987	0.488	cellular process
GO:0048522	0.405	positive regulation of cellular process
GO:0050896	0.366	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005634	0.987	nucleus
GO:0005829	0.891	cytosol
GO:0071944	0.418	cell periphery
GO:0005886	0.399	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]