StarFunc result for job id A0PJZ3

User Input

>input (443 residues)
MKLRSKAAALLLLALAALLLALLSLRAGRAEPPALPARPASAPQRHPAPVPARWPGPGAL
PGASPGVRRRRPPRPRPRAGRRGAARLEKLARRPGEPRSFQAVLPPELWIHLAVVACGNR
LEETLVMLKSAVLFSHRKIQFHIFTEDSLKPEFDKQLRQWPDSYTKKFEHRIYPITFSVG
NPQEWKKLFKPCAAQRLFLPVILKDVDSLLYVDTDVLFLRPVDDIWKLLRLFNSTQLAAM
APEHEIPKIGWYSRFARHPFYGSAGVNSGVMLMNLTRIRSTQFKNSMIPTGLAWEDMLYP
LYQKYKNAITWGDQDLLNIIFYFNPECLYVFPCQWNYRPDHCMYGSNCREAEHEGVSVLH
GNRGVYHDDKQPTFRALYEAIRDFPFQDNLFQSMYYPLQLKFLETVHTLCGRIPQVFLKQ
IEKTMKRAYEKHVIIHVGPNQMH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0PJZ3	1.000	1.000	7.233E-91	443	1.000	1.000	A0PJZ3.pdb.gz	GXLT2_HUMAN Glucoside xylosyltransferase 2 OS=Homo sapiens OX=9606 GN=GXYLT2 PE=2 SV=2
2	AFDB:Q4G148	0.721	0.725	2.029E-55	440	0.519	0.523	Q4G148.pdb.gz	GXLT1_HUMAN Glucoside xylosyltransferase 1 OS=Homo sapiens OX=9606 GN=GXYLT1 PE=1 SV=2
3	AFDB:Q9VBY3	0.683	0.833	1.623E-44	362	0.350	0.428	Q9VBY3.pdb.gz	Q9VBY3_DROME IP22168p OS=Drosophila melanogaster OX=7227 GN=shams PE=2 SV=2
4	AFDB:Q5XPT3	0.470	0.311	1.553E-18	690	0.158	0.101	Q5XPT3.pdb.gz	LARG2_MOUSE Xylosyl- and glucuronyltransferase LARGE2 OS=Mus musculus OX=10090 GN=Large2 PE=1 SV=1
5	AFDB:Q8N3Y3	0.512	0.328	1.755E-18	721	0.210	0.129	Q8N3Y3.pdb.gz	LARG2_HUMAN Xylosyl- and glucuronyltransferase LARGE2 OS=Homo sapiens OX=9606 GN=LARGE2 PE=1 SV=2
6	AFDB:O95461	0.495	0.299	5.973E-18	756	0.172	0.101	O95461.pdb.gz	LARG1_HUMAN Xylosyl- and glucuronyltransferase LARGE1 OS=Homo sapiens OX=9606 GN=LARGE1 PE=1 SV=1
7	AFDB:Q8N5D6	0.370	0.458	6.414E-10	347	0.106	0.135	Q8N5D6.pdb.gz	GBGT1_HUMAN Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=GBGT1 PE=1 SV=2
8	PDB:8cvzI	0.394	0.610	2.209E-9	267	0.104	0.172	8cvzI.pdb.gz
9	PDB:1ll0B	0.386	0.590	7.070E-9	267	0.111	0.184	1ll0B.pdb.gz
10	PDB:4y63A	0.348	0.516	7.070E-9	282	0.072	0.113	4y63A.pdb.gz	Design of Glycosyltransferase Inhibitors: Serine Analogues as Pyrophosphate Surrogates?
11	AFDB:B0B1U2	0.373	0.455	1.750E-8	354	0.111	0.138	B0B1U2.pdb.gz	B0B1U2_HUMAN ABO glycosyltransferase OS=Homo sapiens OX=9606 GN=ABO PE=1 SV=1
12	AFDB:A0A0B4K7X5	0.365	0.305	3.229E-8	545	0.111	0.090	A0A0B4K7X5.pdb.gz	A0A0B4K7X5_DROME Glycogenin, isoform D OS=Drosophila melanogaster OX=7227 GN=Gyg PE=1 SV=1
13	AFDB:Q6V9S8	0.266	0.312	7.158E-8	368	0.117	0.141	Q6V9S8.pdb.gz	Q6V9S8_GOSHI Glycosyltransferases OS=Gossypium hirsutum OX=3635 GN=GT43A1 PE=2 SV=1
14	PDB:1mc3A	0.255	0.357	3.430E-6	291	0.074	0.113	1mc3A.pdb.gz	Crystal Structure of Escherichia coli Glucose-1-Phosphate Thymidylyltransferase (RffH) Complexed with dTTP and Mg2+
15	PDB:1h5sB	0.262	0.356	4.658E-6	291	0.090	0.137	1h5sB.pdb.gz	Kinetic and crystallographic analyses support a sequential-ordered bi bi catalytic mechanism for Escherichia coli glucose-1-phosphate thymidylyltransferase.
16	PDB:6fxrA	0.284	0.193	1.685E-5	700	0.097	0.061	6fxrA.pdb.gz	Molecular architecture of the multifunctional collagen lysyl hydroxylase and glycosyltransferase LH3.
17	PDB:7d72A	0.278	0.298	3.736E-5	407	0.050	0.054	7d72A.pdb.gz	Cryo-EM structures of human GMPPA-GMPPB complex reveal how cells maintain GDP-mannose homeostasis.
18	PDB:7x8kB	0.265	0.309	5.074E-5	367	0.074	0.090	7x8kB.pdb.gz	Crystal Structures of Arabidopsis thaliana GDP-D-Mannose Pyrophosphorylase VITAMIN C DEFECTIVE 1.
19	PDB:6b5eB	0.278	0.385	6.097E-5	286	0.102	0.157	6b5eB.pdb.gz	The structure of glucose-1-phosphate thymidylyltransferase from Mycobacterium tuberculosis reveals the location of an essential magnesium ion in the RmlA-type enzymes.
20	PDB:2oi6B	0.232	0.228	6.482E-5	452	0.043	0.042	2oi6B.pdb.gz	Structure of the E. coli bifunctional GlmU acetyltransferase active site with substrates and products.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0PJZ3	0.0	915	443	1.000	1.000	GXLT2_HUMAN Glucoside xylosyltransferase 2 OS=Homo sapiens OX=9606 GN=GXYLT2 PE=2 SV=2
2	Q4G148	1.33e-159	459	440	0.472	0.475	GXLT1_HUMAN Glucoside xylosyltransferase 1 OS=Homo sapiens OX=9606 GN=GXYLT1 PE=1 SV=2
3	Q9VBY3	3.86e-110	331	362	0.352	0.431	Q9VBY3_DROME IP22168p OS=Drosophila melanogaster OX=7227 GN=shams PE=2 SV=2
4	Q5XPT3	1.57e-10	65.5	690	0.147	0.094	LARG2_MOUSE Xylosyl- and glucuronyltransferase LARGE2 OS=Mus musculus OX=10090 GN=Large2 PE=1 SV=1
5	Q8N3Y3	1.46e-09	62.4	721	0.135	0.083	LARG2_HUMAN Xylosyl- and glucuronyltransferase LARGE2 OS=Homo sapiens OX=9606 GN=LARGE2 PE=1 SV=2
6	O95461	9.02e-07	53.5	756	0.131	0.077	LARG1_HUMAN Xylosyl- and glucuronyltransferase LARGE1 OS=Homo sapiens OX=9606 GN=LARGE1 PE=1 SV=1
7	Q9Z1M7	9.84e-07	53.5	756	0.131	0.077	LARG1_MOUSE Xylosyl- and glucuronyltransferase LARGE1 OS=Mus musculus OX=10090 GN=Large1 PE=1 SV=1
8	Q3U4G3	3.02e-05	48.5	392	0.099	0.112	XXLT1_MOUSE Xyloside xylosyltransferase 1 OS=Mus musculus OX=10090 GN=Xxylt1 PE=1 SV=2
9	Q9W1D1	0.004	42.0	458	0.176	0.170	Q9W1D1_DROME FI19481p1 OS=Drosophila melanogaster OX=7227 GN=Xxylt PE=2 SV=1
10	Q8NBI6	0.006	41.2	393	0.081	0.092	XXLT1_HUMAN Xyloside xylosyltransferase 1 OS=Homo sapiens OX=9606 GN=XXYLT1 PE=1 SV=1
11	O04536	0.057	38.1	390	0.126	0.144	GATL9_ARATH Probable galacturonosyltransferase-like 9 OS=Arabidopsis thaliana OX=3702 GN=GATL9 PE=2 SV=1
12	Q6PDL0	0.079	37.7	492	0.056	0.051	DC1L2_MOUSE Cytoplasmic dynein 1 light intermediate chain 2 OS=Mus musculus OX=10090 GN=Dync1li2 PE=1 SV=2
13	Q9Y6V0	0.14	37.4	5142	0.052	0.004	PCLO_HUMAN Protein piccolo OS=Homo sapiens OX=9606 GN=PCLO PE=1 SV=5
14	Q8T191	0.29	36.2	1681	0.120	0.032	UGGG_DICDI Probable UDP-glucose:glycoprotein glucosyltransferase A OS=Dictyostelium discoideum OX=44689 GN=ggtA PE=1 SV=2
15	O43237	0.46	35.4	492	0.043	0.039	DC1L2_HUMAN Cytoplasmic dynein 1 light intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1LI2 PE=1 SV=1
16	Q99PP2	0.52	35.4	2237	0.072	0.014	ZN318_MOUSE Zinc finger protein 318 OS=Mus musculus OX=10090 GN=Znf318 PE=1 SV=3
17	Q9JKS6	0.75	35.0	5085	0.050	0.004	PCLO_RAT Protein piccolo OS=Rattus norvegicus OX=10116 GN=Pclo PE=1 SV=1
18	H2KYA5	1.3	34.3	1793	0.045	0.011	H2KYA5_CAEEL Protein kinase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-82 PE=1 SV=1
19	Q9QYX7	2.0	33.5	5068	0.043	0.004	PCLO_MOUSE Protein piccolo OS=Mus musculus OX=10090 GN=Pclo PE=1 SV=4
20	Q9LHD2	2.9	32.7	365	0.065	0.079	GATLA_ARATH Probable galacturonosyltransferase-like 10 OS=Arabidopsis thaliana OX=3702 GN=GATL10 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18404 Glyco_transf_24	6.6	17.6	Glucosyltransferase 24
2	PF01501 Glyco_transf_8	3.4e-09	48.2	Glycosyl transferase family 8

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000374268

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259253	0.912	UDP-glucose:glycoprotein glucosyltransferase 1
2	9606.ENSP00000309640	0.839	Xyloside xylosyltransferase 1
3	9606.ENSP00000381666	0.810	Glucoside xylosyltransferase 1
4	9606.ENSP00000364731	0.769	Coagulation factor VII
5	9606.ENSP00000295588	0.693	Protein O-glucosyltransferase 1
6	9606.ENSP00000315386	0.654	KDEL motif-containing protein 2
7	9606.ENSP00000315182	0.651	Protein SHQ1 homolog
8	9606.ENSP00000365172	0.649	KDEL motif-containing protein 1
9	9606.ENSP00000393324	0.648	Eukaryotic translation initiation factor 4E type 3
10	9606.ENSP00000363017	0.645	Replication protein A 32 kDa subunit
11	9606.ENSP00000481096	0.640	Alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase C
12	9606.ENSP00000350716	0.603	Tumor suppressor candidate 1
13	9606.ENSP00000307971	0.545	Beta-1,3-N-acetylglucosaminyltransferase radical fringe
14	9606.ENSP00000283303	0.541	Adhesion G protein-coupled receptor F4
15	9606.ENSP00000467083	0.535	PWWP domain-containing protein MUM1
16	9606.ENSP00000277541	0.523	Neurogenic locus notch homolog protein 1
17	9606.ENSP00000384363	0.500	Lysophospholipase D GDPD3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035252	1.000	UDP-xylosyltransferase activity
GO:0005488	0.859	binding
GO:0005515	0.836	protein binding
GO:0016758	0.599	hexosyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0044237	0.984	cellular metabolic process
GO:0006807	0.983	nitrogen compound metabolic process
GO:0043170	0.973	macromolecule metabolic process
GO:0044260	0.933	cellular macromolecule metabolic process
GO:1901564	0.901	organonitrogen compound metabolic process
GO:1901135	0.886	carbohydrate derivative metabolic process
GO:0036211	0.884	protein modification process
GO:1901576	0.879	organic substance biosynthetic process
GO:0044249	0.878	cellular biosynthetic process
GO:0034645	0.873	cellular macromolecule biosynthetic process
GO:0009100	0.837	glycoprotein metabolic process
GO:1901137	0.833	carbohydrate derivative biosynthetic process
GO:1901566	0.829	organonitrogen compound biosynthetic process
GO:0006493	0.808	protein O-linked glycosylation
GO:0016266	0.507	O-glycan processing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0016020	0.997	membrane
GO:0031090	0.937	organelle membrane
GO:0005794	0.648	Golgi apparatus
GO:0005886	0.435	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.2.-	1.000	Pentosyltransferases.
EC:2.4.1.-	0.599	Hexosyltransferases.

[back to server]