StarFunc result for job id A0ZSE6

User Input

>input (113 residues)
MEERAQHCLSRLLDNSALKQQELPIHRLYFTARRVLFVFFATGIFCLCMGIILILSARST
QEIEINYTRICANCAKLRENASNFDKECTCSIPFYLSGKMMVGEIQETRLTLH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O97240	0.206	0.047	2.109	617	0.177	0.032	O97240.pdb.gz	APEX_PLAF7 DNA-(apurinic or apyrimidinic site) endonuclease OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=APE1 PE=1 SV=2
2	PDB:6hivCH	0.233	0.110	4.425	273	0.106	0.044	6hivCH.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
3	AFDB:P25587	0.174	0.094	5.877	256	0.195	0.086	P25587.pdb.gz	LDB16_YEAST Protein LDB16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LDB16 PE=1 SV=2
4	AFDB:Q95ZJ1	0.242	0.051	6.804	626	0.115	0.021	Q95ZJ1.pdb.gz	GALT5_CAEEL Polypeptide N-acetylgalactosaminyltransferase 5 OS=Caenorhabditis elegans OX=6239 GN=gly-5 PE=2 SV=2
5	AFDB:Q9C5J8	0.181	0.043	6.804	732	0.088	0.014	Q9C5J8.pdb.gz	OEP80_ARATH Outer envelope protein 80, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OEP80 PE=2 SV=1
6	AFDB:P53155	0.262	0.085	7.321	381	0.106	0.031	P53155.pdb.gz	YGI2_YEAST Uncharacterized protein YGL082W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YGL082W PE=1 SV=1
7	AFDB:Q1LXH5	0.153	0.048	7.321	488	0.142	0.033	Q1LXH5.pdb.gz
8	AFDB:Q5JRM2	0.240	0.077	7.321	361	0.124	0.039	Q5JRM2.pdb.gz	CX066_HUMAN Uncharacterized protein CXorf66 OS=Homo sapiens OX=9606 GN=CXorf66 PE=1 SV=1
9	AFDB:Q9P2E8	0.158	0.060	7.321	410	0.080	0.022	Q9P2E8.pdb.gz	MARH4_HUMAN E3 ubiquitin-protein ligase MARCHF4 OS=Homo sapiens OX=9606 GN=MARCHF4 PE=2 SV=2
10	AFDB:Q386T1	0.140	0.029	7.876	862	0.142	0.019	Q386T1.pdb.gz	Q386T1_TRYB2 BRO1 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.18.0002 PE=4 SV=1
11	AFDB:Q28362	0.200	0.035	8.475	839	0.177	0.024	Q28362.pdb.gz	SL9A3_DIDVI Sodium/hydrogen exchanger 3 OS=Didelphis virginiana OX=9267 GN=SLC9A3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3MIR4	3.27e-04	40.4	351	0.230	0.074	CC50B_HUMAN Cell cycle control protein 50B OS=Homo sapiens OX=9606 GN=TMEM30B PE=1 SV=1
2	Q9SA35	0.007	37.0	336	0.195	0.065	ALIS4_ARATH Putative ALA-interacting subunit 4 OS=Arabidopsis thaliana OX=3702 GN=ALIS4 PE=2 SV=2
3	Q8L8W0	0.022	35.4	350	0.150	0.049	ALIS5_ARATH ALA-interacting subunit 5 OS=Arabidopsis thaliana OX=3702 GN=ALIS5 PE=1 SV=1
4	Q38DJ5	0.025	35.0	388	0.150	0.044	Q38DJ5_TRYB2 LEM3 (Ligand-effect modulator 3) family / CDC50 family OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3110 PE=3 SV=1
5	Q19635	0.044	34.7	361	0.186	0.058	Q19635_CAEEL Cell cycle control protein 50A OS=Caenorhabditis elegans OX=6239 GN=cdc-50.b PE=3 SV=1
6	G3HH32	0.051	34.3	363	0.292	0.091	G3HH32_CRIGR Cell cycle control protein OS=Cricetulus griseus OX=10029 GN=Tmem30a PE=3 SV=1
7	Q8VEK0	0.054	34.3	364	0.292	0.091	CC50A_MOUSE Cell cycle control protein 50A OS=Mus musculus OX=10090 GN=Tmem30a PE=1 SV=1
8	Q17QL5	0.089	33.5	361	0.292	0.091	CC50A_BOVIN Cell cycle control protein 50A OS=Bos taurus OX=9913 GN=TMEM30A PE=1 SV=1
9	Q1MTQ5	0.32	32.0	396	0.204	0.058	MUG89_SCHPO Phospholipid-transporting ATPase accessory subunit mug89 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug89 PE=2 SV=1
10	Q9NV96	0.57	31.2	361	0.283	0.089	CC50A_HUMAN Cell cycle control protein 50A OS=Homo sapiens OX=9606 GN=TMEM30A PE=1 SV=1
11	Q8L586	0.68	31.2	287	0.159	0.063	Y4958_ARATH Uncharacterized membrane protein At4g09580 OS=Arabidopsis thaliana OX=3702 GN=At4g09580 PE=1 SV=1
12	Q9R016	1.1	30.8	1403	0.195	0.016	BIR1E_MOUSE Baculoviral IAP repeat-containing protein 1e OS=Mus musculus OX=10090 GN=Naip5 PE=1 SV=3
13	A0A509ASE5	1.6	30.0	5367	0.124	0.003	A0A509ASE5_PLABA Protein SOC2 OS=Plasmodium berghei (strain Anka) OX=5823 GN=PBANKA_1442200 PE=4 SV=1
14	P25656	1.8	30.0	391	0.168	0.049	CDC50_YEAST Phospholipid-transporting ATPase accessory subunit CDC50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC50 PE=1 SV=1
15	Q382L6	3.5	28.9	470	0.133	0.032	Q382L6_TRYB2 LEM3 (Ligand-effect modulator 3) family / CDC50 family OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4760 PE=3 SV=1
16	P53740	4.0	28.9	393	0.212	0.061	YN8S_YEAST Phospholipid-transporting ATPase accessory subunit CRF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNR048W PE=1 SV=1
17	Q9HXN4	4.5	28.9	570	0.124	0.025	Q9HXN4_PSEAE N-Acetyl-D-Glucosamine phosphotransferase system transporter OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA3761 PE=4 SV=1
18	Q9LTW0	4.5	28.9	350	0.133	0.043	ALIS1_ARATH ALA-interacting subunit 1 OS=Arabidopsis thaliana OX=3702 GN=ALIS1 PE=1 SV=1
19	F1QUW3	6.1	28.5	312	0.133	0.048	F1QUW3_DANRE Hydroxycarboxylic acid receptor 1-4 OS=Danio rerio OX=7955 GN=hcar1-4 PE=3 SV=1
20	Q9JIB6	6.2	28.5	1403	0.168	0.014	BIR1F_MOUSE Baculoviral IAP repeat-containing protein 1f OS=Mus musculus OX=10090 GN=Naip6 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03381 CDC50	40	15.1	LEM3 (ligand-effect modulator 3) family / CDC50 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000056080

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000012069	0.876	ATPase, class I, type 8B, member 4
2	9598.ENSPTRP00000040761	0.865	ATPase, aminophospholipid transporter, class I, type 8B, member 2
3	9598.ENSPTRP00000046685	0.863	ATPase, aminophospholipid transporter, class I, type 8A, member 2
4	9598.ENSPTRP00000029885	0.852	ATPase, class V, type 10B
5	9598.ENSPTRP00000038477	0.852	ATPase, class VI, type 11C
6	9598.ENSPTRP00000017073	0.826	ATPase, aminophospholipid transporter, class I, type 8B, member 1
7	9598.ENSPTRP00000027584	0.821	ATPase, class V, type 10D
8	9598.ENSPTRP00000051672	0.819	ATPase, class V, type 10A
9	9598.ENSPTRP00000010278	0.805	ATPase, class VI, type 11A
10	9598.ENSPTRP00000026946	0.804	ATPase, class VI, type 11B
11	9598.ENSPTRP00000027564	0.790	ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1
12	9598.ENSPTRP00000042126	0.633	ATPase, class II, type 9B
13	9598.ENSPTRP00000023446	0.590	ATPase, class II, type 9A
14	9598.ENSPTRP00000024056	0.520	Uncharacterized protein
15	9598.ENSPTRP00000010960	0.514	ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005215	0.526	transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.872	cellular process
GO:0065007	0.661	biological regulation
GO:0006810	0.485	transport
GO:0050789	0.412	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0012505	0.998	endomembrane system
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0016020	0.982	membrane
GO:0071944	0.885	cell periphery
GO:0005886	0.864	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]