StarFunc result for job id A1A4Y4

User Input

>input (181 residues)
MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEG
KASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVAS
AQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCE
Y

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1A4Y4	1.000	1.000	3.303E-37	181	1.000	1.000	A1A4Y4.pdb.gz	IRGM_HUMAN Immunity-related GTPase family M protein OS=Homo sapiens OX=9606 GN=IRGM PE=1 SV=2
2	AFDB:A0A140LIF8	0.823	0.387	6.189E-18	407	0.519	0.231	A0A140LIF8.pdb.gz	IRGM2_MOUSE Immunity-related GTPase family M protein 2 OS=Mus musculus OX=10090 GN=Irgm2 PE=1 SV=2
3	AFDB:Q60766	0.829	0.387	8.746E-17	409	0.530	0.235	Q60766.pdb.gz	IRGM1_MOUSE Immunity-related GTPase family M protein 1 OS=Mus musculus OX=10090 GN=Irgm1 PE=1 SV=1
4	AFDB:Q811M6	0.797	0.366	1.208E-16	423	0.503	0.215	Q811M6.pdb.gz	Q811M6_MOUSE Interferon gamma induced GTPase OS=Mus musculus OX=10090 GN=Igtp PE=2 SV=1
5	AFDB:Q0GUM2	0.734	0.349	3.792E-14	417	0.365	0.158	Q0GUM2.pdb.gz
6	AFDB:Q62293	0.779	0.368	4.602E-14	415	0.343	0.149	Q62293.pdb.gz	TGTP1_MOUSE T-cell-specific guanine nucleotide triphosphate-binding protein 1 OS=Mus musculus OX=10090 GN=Tgtp1 PE=1 SV=1
7	AFDB:Q3U0K0	0.790	0.368	3.409E-13	420	0.354	0.152	Q3U0K0.pdb.gz	Q3U0K0_MOUSE IRG-type G domain-containing protein OS=Mus musculus OX=10090 GN=Ifi47 PE=2 SV=1
8	AFDB:Q3UED7	0.732	0.362	8.983E-13	406	0.348	0.155	Q3UED7.pdb.gz	Q3UED7_MOUSE Interferon-gamma-inducible GTPase Ifgga2 protein OS=Mus musculus OX=10090 GN=Iigp1c PE=1 SV=1
9	AFDB:Q9QZ85	0.727	0.352	1.269E-11	413	0.331	0.145	Q9QZ85.pdb.gz	IIGP1_MOUSE Interferon-inducible GTPase 1 OS=Mus musculus OX=10090 GN=Iigp1 PE=1 SV=2
10	PDB:1tq6A	0.718	0.359	1.624E-11	402	0.326	0.147	1tq6A.pdb.gz	Crystal Structure of IIGP1; A Paradigm for Interferon-Inducible p47 Resistance GTPases
11	AFDB:Q6NXR0	0.702	0.286	1.870E-11	463	0.326	0.127	Q6NXR0.pdb.gz	IIGP5_HUMAN Interferon-inducible GTPase 5 OS=Homo sapiens OX=9606 GN=IRGC PE=1 SV=1
12	PDB:1tqdB	0.690	0.359	8.707E-11	379	0.315	0.150	1tqdB.pdb.gz
13	PDB:1puiA	0.484	0.516	8.041E-6	169	0.177	0.189	1puiA.pdb.gz
14	PDB:4cidA	0.534	0.222	5.584E-5	497	0.188	0.068	4cidA.pdb.gz	Structural Insights Into Membrane Interaction and Caveolar Targeting of Dynamin-Like Ehd2.
15	PDB:4kvaB	0.524	0.383	5.584E-5	258	0.133	0.093	4kvaB.pdb.gz	Crystal Structure of a Schistosoma mansoni Septin Reveals the Phenomenon of Strand Slippage in Septins Dependent on the Nature of the Bound Nucleotide.
16	PDB:2x77A	0.441	0.441	7.712E-5	181	0.138	0.138	2x77A.pdb.gz	Crystal Structure of Leishmania Major Adp Ribosylation Factor-Like 1 and a Classification of Related Gtpase Family Members in This Kinetoplastid.
17	PDB:7m6jD	0.542	0.387	8.776E-5	273	0.199	0.132	7m6jD.pdb.gz	An atomic model for the human septin hexamer by cryo-EM.
18	PDB:1sulB	0.537	0.504	9.986E-5	195	0.160	0.149	1sulB.pdb.gz
19	PDB:7pubIA	0.490	0.149	1.136E-4	693	0.149	0.039	7pubIA.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
20	PDB:2f9mA	0.402	0.401	1.471E-4	182	0.138	0.137	2f9mA.pdb.gz	The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1A4Y4	1.77e-136	380	181	1.000	1.000	IRGM_HUMAN Immunity-related GTPase family M protein OS=Homo sapiens OX=9606 GN=IRGM PE=1 SV=2
2	Q60766	1.09e-62	201	409	0.552	0.244	IRGM1_MOUSE Immunity-related GTPase family M protein 1 OS=Mus musculus OX=10090 GN=Irgm1 PE=1 SV=1
3	A0A140LIF8	1.48e-57	187	407	0.514	0.229	IRGM2_MOUSE Immunity-related GTPase family M protein 2 OS=Mus musculus OX=10090 GN=Irgm2 PE=1 SV=2
4	Q3U5T3	2.21e-55	178	278	0.519	0.338	Q3U5T3_MOUSE IRG-type G domain-containing protein OS=Mus musculus OX=10090 GN=Igtp PE=2 SV=1
5	Q9DCE9	2.46e-54	179	423	0.519	0.222	IRGM3_MOUSE Immunity-related GTPase family M protein 3 OS=Mus musculus OX=10090 GN=Igtp PE=1 SV=1
6	Q811M6	8.13e-54	178	423	0.519	0.222	Q811M6_MOUSE Interferon gamma induced GTPase OS=Mus musculus OX=10090 GN=Igtp PE=2 SV=1
7	Q8K242	3.79e-34	126	415	0.343	0.149	Q8K242_MOUSE Tgtp protein OS=Mus musculus OX=10090 PE=2 SV=1
8	Q0GUM3	2.87e-33	124	417	0.381	0.165	IRB10_MOUSE Interferon-gamma-inducible GTPase 10 OS=Mus musculus OX=10090 GN=Gm12250 PE=1 SV=1
9	Q99M59	2.98e-32	121	420	0.387	0.167	Q99M59_MOUSE Interferon gamma inducible protein 47 OS=Mus musculus OX=10090 GN=Ifi47 PE=2 SV=1
10	Q62293	1.26e-31	119	415	0.343	0.149	TGTP1_MOUSE T-cell-specific guanine nucleotide triphosphate-binding protein 1 OS=Mus musculus OX=10090 GN=Tgtp1 PE=1 SV=1
11	A0A1L1SQM2	3.84e-31	113	197	0.315	0.289	A0A1L1SQM2_MOUSE Interferon gamma inducible protein 47 (Fragment) OS=Mus musculus OX=10090 GN=Ifi47 PE=1 SV=1
12	Q61635	3.91e-31	118	420	0.381	0.164	Q61635_MOUSE GTP-binding protein OS=Mus musculus OX=10090 GN=Ifi47 PE=1 SV=1
13	Q3UED7	2.66e-30	115	406	0.343	0.153	Q3UED7_MOUSE Interferon-gamma-inducible GTPase Ifgga2 protein OS=Mus musculus OX=10090 GN=Iigp1c PE=1 SV=1
14	Q3U0K0	1.00e-29	114	420	0.376	0.162	Q3U0K0_MOUSE IRG-type G domain-containing protein OS=Mus musculus OX=10090 GN=Ifi47 PE=2 SV=1
15	Q9QZ85	4.99e-26	104	413	0.326	0.143	IIGP1_MOUSE Interferon-inducible GTPase 1 OS=Mus musculus OX=10090 GN=Iigp1 PE=1 SV=2
16	Q6NXR0	1.83e-23	98.2	463	0.320	0.125	IIGP5_HUMAN Interferon-inducible GTPase 5 OS=Homo sapiens OX=9606 GN=IRGC PE=1 SV=1
17	Q8K1X4	0.21	34.3	1134	0.077	0.012	NCKPL_MOUSE Nck-associated protein 1-like OS=Mus musculus OX=10090 GN=Nckap1l PE=1 SV=1
18	Q94464	0.47	33.1	853	0.160	0.034	DYNA_DICDI Dynamin-A OS=Dictyostelium discoideum OX=44689 GN=dymA PE=1 SV=2
19	Q9VQE0	0.49	33.1	735	0.155	0.038	Q9VQE0_DROME Dynamin related protein 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Drp1 PE=1 SV=1
20	Q8IHG0	0.50	33.1	735	0.155	0.038	Q8IHG0_DROME AT04516p OS=Drosophila melanogaster OX=7227 GN=Drp1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05049 IIGP	1.7e-61	220.0	Interferon-inducible GTPase (IIGP)
2	PF02401 LYTB	3e+02	12.1	LytB protein
3	PF01926 MMR_HSR1	56	15.3	50S ribosome-binding GTPase
4	PF03193 RsgA_GTPase	3.3e+02	12.6	RsgA GTPase
5	PF14532 Sigma54_activ_2	2.5e+02	13.2	Sigma-54 interaction domain
6	PF00448 SRP54	4.6e+02	11.8	SRP54-type protein, GTPase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000428220

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358072	0.989	Autophagy protein 5
2	9606.ENSP00000300589	0.965	Nucleotide-binding oligomerization domain-containing protein 2
3	9606.ENSP00000375872	0.951	Autophagy-related protein 16-1
4	9606.ENSP00000355231	0.918	Beclin-1
5	9606.ENSP00000357674	0.886	SNARE-associated protein Snapin
6	9606.ENSP00000397178	0.764	Zinc finger protein 300
7	9606.ENSP00000259400	0.758	Syntaxin-17
8	9606.ENSP00000418194	0.702	Poly [ADP-ribose] polymerase 14
9	9606.ENSP00000353512	0.696	Poly [ADP-ribose] polymerase 9
10	9606.ENSP00000321345	0.681	Interleukin-23 receptor
11	9606.ENSP00000222823	0.676	Nucleotide-binding oligomerization domain-containing protein 1
12	9606.ENSP00000324560	0.676	Serine/threonine-protein kinase ULK1
13	9606.ENSP00000263864	0.671	Vesicle-associated membrane protein 8
14	9606.ENSP00000282185	0.671	Ubiquitin-like-conjugating enzyme ATG10
15	9606.ENSP00000354394	0.645	Signal transducer and activator of transcription 1-alpha/beta
16	9606.ENSP00000377003	0.643	Tetraspanin-8
17	9606.ENSP00000479919	0.636	Endophilin-B1
18	9606.ENSP00000431926	0.620	Activating molecule in BECN1-regulated autophagy protein 1
19	9606.ENSP00000374455	0.612	Sequestosome-1
20	9606.ENSP00000425107	0.610	Ubiquitin-like protein ATG12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019904	0.998	protein domain specific binding
GO:0019901	0.997	protein kinase binding
GO:0019207	0.996	kinase regulator activity
GO:0008047	0.996	enzyme activator activity
GO:0051400	0.990	BH domain binding
GO:0043539	0.990	protein serine/threonine kinase activator activity
GO:0003824	0.975	catalytic activity
GO:0016787	0.585	hydrolase activity
GO:0016817	0.480	hydrolase activity, acting on acid anhydrides
GO:0016462	0.459	pyrophosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0009987	0.988	cellular process
GO:0009605	0.947	response to external stimulus
GO:0051707	0.926	response to other organism
GO:0051716	0.925	cellular response to stimulus
GO:0065007	0.910	biological regulation
GO:0050794	0.897	regulation of cellular process
GO:0048518	0.755	positive regulation of biological process
GO:0019222	0.711	regulation of metabolic process
GO:0006950	0.694	response to stress
GO:0042221	0.683	response to chemical
GO:0006952	0.648	defense response
GO:0008152	0.643	metabolic process
GO:0010033	0.643	response to organic substance
GO:0006955	0.634	immune response
GO:0098542	0.602	defense response to other organism
GO:0071310	0.583	cellular response to organic substance
GO:0031323	0.575	regulation of cellular metabolic process
GO:0048522	0.566	positive regulation of cellular process
GO:0071704	0.515	organic substance metabolic process
GO:0060255	0.513	regulation of macromolecule metabolic process
GO:0044238	0.504	primary metabolic process
GO:0044237	0.478	cellular metabolic process
GO:0006807	0.448	nitrogen compound metabolic process
GO:0007154	0.447	cell communication
GO:0009893	0.445	positive regulation of metabolic process
GO:0080090	0.439	regulation of primary metabolic process
GO:0051171	0.435	regulation of nitrogen compound metabolic process
GO:0023052	0.425	signaling
GO:0048583	0.419	regulation of response to stimulus
GO:0007165	0.411	signal transduction
GO:0031347	0.400	regulation of defense response
GO:0043170	0.398	macromolecule metabolic process
GO:0031329	0.398	regulation of cellular catabolic process
GO:1901564	0.380	organonitrogen compound metabolic process
GO:0061919	0.379	process utilizing autophagic mechanism
GO:0031325	0.378	positive regulation of cellular metabolic process
GO:0023051	0.377	regulation of signaling
GO:0010646	0.374	regulation of cell communication
GO:0050776	0.364	regulation of immune response
GO:0002684	0.363	positive regulation of immune system process
GO:0009617	0.362	response to bacterium
GO:0032101	0.334	regulation of response to external stimulus
GO:0009966	0.334	regulation of signal transduction
GO:0019538	0.326	protein metabolic process
GO:0048584	0.322	positive regulation of response to stimulus
GO:0010604	0.304	positive regulation of macromolecule metabolic process
GO:0010506	0.303	regulation of autophagy

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.999	membrane
GO:0012505	0.999	endomembrane system
GO:0005829	0.999	cytosol
GO:0031090	0.969	organelle membrane
GO:0098588	0.964	bounding membrane of organelle
GO:0005739	0.932	mitochondrion
GO:0005794	0.865	Golgi apparatus
GO:0000139	0.660	Golgi membrane
GO:0043233	0.339	organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.585	Hydrolases.
EC:3.6.-.-	0.480	Acting on acid anhydrides.
EC:3.6.1.-	0.459	In phosphorus-containing anhydrides.

[back to server]