StarFunc result for job id A1A5B4

User Input

>input (782 residues)
MQGEESLRILVEPEGDSFPLMEISTCETEASEQWDYVLVAQRHTQRDPRQARQQQFLEEL
RRKGFHIKVIRDQKQVFFGIRADNSVFGLYRTLLLEPEGPAPHAELAAPTTIPVTTSLRI
RIVNFVVMNNKTSAGETFEDLMKDGVFEARFPLHKGEGRLKKTWARWRHMFREQPVDEIR
NYFGEKVALYFVWLGWYTYMLVPAALTGLLVFLSGFSLFEASQISKEICEAHDILMCPLG
DHSRRYQRLSETCTFAKLTHLFDNDGTVVFAIFMALWATVFLEIWKRQRARVVLHWDLYV
WDEEQEEMALQLINCPDYKLRPYQHSYLRSTVILVLTLLMICLMIGMAHVLVVYRVLASA
LFSSSAVPFLEEQVTTAVVVTGALVHYVTIIIMTKINRCVALKLCDFEMPRTFSERESRF
TIRFFTLQFFTHFSSLIYIAFILGRINGHPGKSTRLAGLWKLEECHASGCMMDLFVQMAI
IMGLKQTLSNCVEYLVPWVTHKCRSLRASESGHLPRDPELRDWRRNYLLNPVNTFSLFDE
FMEMMIQYGFTTIFVAAFPLAPLLALFSNLVEIRLDAIKMVWLQRRLVPRKAKDIGTWLQ
VLETIGVLAVIANGMVIAFTSEFIPRVVYKYRYSPCLKEGNSTVDCLKGYVNHSLSVFHT
KDFQDPDGIEGSENVTLCRYRDYRNPPDYNFSEQFWFLLAIRLAFVILFEHVALCIKLIA
AWFVPDIPQSVKNKVLEVKYQRLREKMWHGRQRLGGVGAGSRPPMPAHPTPASIFSARST
DV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1A5B4	1.000	1.000	0.000	782	1.000	1.000	A1A5B4.pdb.gz	ANO9_HUMAN Anoctamin-9 OS=Homo sapiens OX=9606 GN=ANO9 PE=1 SV=3
2	AFDB:P86044	0.899	0.940	3.476E-83	747	0.702	0.735	P86044.pdb.gz	ANO9_MOUSE Anoctamin-9 OS=Mus musculus OX=10090 GN=Ano9 PE=1 SV=1
3	AFDB:Q32M45	0.840	0.693	1.801E-54	955	0.390	0.319	Q32M45.pdb.gz	ANO4_HUMAN Anoctamin-4 OS=Homo sapiens OX=9606 GN=ANO4 PE=2 SV=1
4	AFDB:A2AHL1	0.833	0.670	1.159E-51	981	0.390	0.311	A2AHL1.pdb.gz	ANO3_MOUSE Anoctamin-3 OS=Mus musculus OX=10090 GN=Ano3 PE=1 SV=1
5	AFDB:A0A0B4JCY1	0.794	0.573	6.532E-49	1099	0.321	0.228	A0A0B4JCY1.pdb.gz	A0A0B4JCY1_DROME Anoctamin OS=Drosophila melanogaster OX=7227 GN=subdued PE=3 SV=1
6	AFDB:D4A915	0.803	0.611	1.797E-48	1040	0.344	0.259	D4A915.pdb.gz	D4A915_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=3 SV=1
7	AFDB:Q9VDV4	0.792	0.585	2.915E-48	1075	0.327	0.238	Q9VDV4.pdb.gz	Q9VDV4_DROME Anoctamin OS=Drosophila melanogaster OX=7227 GN=subdued PE=2 SV=1
8	AFDB:Q5XXA6	0.791	0.633	3.966E-48	986	0.347	0.275	Q5XXA6.pdb.gz	ANO1_HUMAN Anoctamin-1 OS=Homo sapiens OX=9606 GN=ANO1 PE=1 SV=1
9	AFDB:Q8BHY3	0.791	0.650	1.140E-47	960	0.345	0.281	Q8BHY3.pdb.gz	ANO1_MOUSE Anoctamin-1 OS=Mus musculus OX=10090 GN=Ano1 PE=1 SV=2
10	AFDB:Q75UR0	0.822	0.715	2.110E-47	904	0.343	0.296	Q75UR0.pdb.gz	ANO5_MOUSE Anoctamin-5 OS=Mus musculus OX=10090 GN=Ano5 PE=2 SV=1
11	PDB:8b8kA	0.780	0.821	5.060E-45	741	0.324	0.341	8b8kA.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
12	PDB:7zk3A	0.770	0.833	1.292E-42	721	0.307	0.333	7zk3A.pdb.gz	Inhibition mechanism of the chloride channel TMEM16A by the pore blocker 1PBC.
13	PDB:8b8jA	0.763	0.838	2.392E-42	709	0.318	0.351	8b8jA.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
14	PDB:7b5dA	0.756	0.840	1.310E-40	701	0.299	0.334	7b5dA.pdb.gz
15	PDB:8b8mB	0.740	0.844	1.310E-40	682	0.315	0.361	8b8mB.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
16	PDB:8bc0B	0.711	0.868	3.497E-38	636	0.301	0.369	8bc0B.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
17	PDB:8bc1A	0.614	0.898	9.054E-34	527	0.267	0.397	8bc1A.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
18	PDB:6p47A	0.739	0.793	1.580E-32	725	0.318	0.343	6p47A.pdb.gz
19	PDB:6bgjA	0.495	0.762	3.470E-20	490	0.234	0.373	6bgjA.pdb.gz	Cryo-EM structures of the TMEM16A calcium-activated chloride channel.
20	PDB:6bgiA	0.538	0.803	8.741E-20	510	0.249	0.382	6bgiA.pdb.gz	Cryo-EM structures of the TMEM16A calcium-activated chloride channel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1A5B4	0.0	1625	782	1.000	1.000	ANO9_HUMAN Anoctamin-9 OS=Homo sapiens OX=9606 GN=ANO9 PE=1 SV=3
2	P86044	0.0	1097	747	0.699	0.732	ANO9_MOUSE Anoctamin-9 OS=Mus musculus OX=10090 GN=Ano9 PE=1 SV=1
3	Q32M45	2.36e-177	536	955	0.376	0.308	ANO4_HUMAN Anoctamin-4 OS=Homo sapiens OX=9606 GN=ANO4 PE=2 SV=1
4	Q8C5H1	6.39e-177	535	955	0.375	0.307	ANO4_MOUSE Anoctamin-4 OS=Mus musculus OX=10090 GN=Ano4 PE=1 SV=2
5	F1M0A0	2.68e-163	500	981	0.367	0.293	F1M0A0_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano3 PE=3 SV=4
6	A2AHL1	3.58e-163	499	981	0.364	0.291	ANO3_MOUSE Anoctamin-3 OS=Mus musculus OX=10090 GN=Ano3 PE=1 SV=1
7	Q9BYT9	2.01e-162	498	981	0.362	0.288	ANO3_HUMAN Anoctamin-3 OS=Homo sapiens OX=9606 GN=ANO3 PE=1 SV=2
8	Q75V66	6.82e-142	442	913	0.341	0.292	ANO5_HUMAN Anoctamin-5 OS=Homo sapiens OX=9606 GN=ANO5 PE=1 SV=1
9	A0A0G2K052	4.03e-138	436	1039	0.318	0.240	A0A0G2K052_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=1 SV=2
10	Q8BHY3	8.92e-138	433	960	0.322	0.263	ANO1_MOUSE Anoctamin-1 OS=Mus musculus OX=10090 GN=Ano1 PE=1 SV=2
11	D4A915	1.26e-136	432	1040	0.317	0.238	D4A915_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=3 SV=1
12	A0A8I6GL36	1.28e-136	431	990	0.313	0.247	A0A8I6GL36_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=1 SV=1
13	A0A8I6AHD2	7.97e-136	425	865	0.326	0.295	A0A8I6AHD2_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
14	A0A8I6G530	1.25e-135	425	887	0.326	0.287	A0A8I6G530_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
15	A0A8I6ASC3	1.46e-135	425	888	0.326	0.287	A0A8I6ASC3_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
16	A0A8I5ZRU7	2.28e-135	425	911	0.326	0.280	A0A8I5ZRU7_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
17	A0A0G2K1M7	2.68e-135	425	909	0.327	0.282	A0A0G2K1M7_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
18	A0A8I5Y1S2	3.68e-135	425	924	0.327	0.277	A0A8I5Y1S2_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
19	A0A8I6AA94	3.98e-135	425	932	0.327	0.275	A0A8I6AA94_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
20	Q5XXA6	6.03e-135	426	986	0.329	0.261	ANO1_HUMAN Anoctamin-1 OS=Homo sapiens OX=9606 GN=ANO1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04547 Anoctamin	1.5e-127	438.0	Calcium-activated chloride channel
2	PF16178 Anoct_dimer	0.00024	32.4	Dimerisation domain of Ca+-activated chloride-channel, anoctamin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000332788

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000403104	0.673	Single Ig IL-1-related receptor
2	9606.ENSP00000432487	0.625	Protein SAAL1
3	9606.ENSP00000266673	0.622	Transmembrane protein 19
4	9606.ENSP00000368017	0.622	Zinc finger C3H1 domain-containing protein
5	9606.ENSP00000386959	0.622	Calcyphosin-2
6	9606.ENSP00000331678	0.606	Plakophilin-3
7	9606.ENSP00000380646	0.542	Transmembrane protein 80
8	9606.ENSP00000380958	0.541	Myelin basic protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005229	1.000	intracellular calcium activated chloride channel activity
GO:0022839	0.827	monoatomic ion gated channel activity
GO:0017128	0.797	phospholipid scramblase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0009987	0.992	cellular process
GO:0050794	0.964	regulation of cellular process
GO:0051179	0.941	localization
GO:0051234	0.920	establishment of localization
GO:0015698	0.901	inorganic anion transport
GO:0006811	0.899	monoatomic ion transport
GO:0051049	0.817	regulation of transport
GO:0048519	0.801	negative regulation of biological process
GO:0034765	0.786	regulation of monoatomic ion transmembrane transport
GO:0048523	0.782	negative regulation of cellular process
GO:0055085	0.764	transmembrane transport
GO:0065009	0.643	regulation of molecular function
GO:0034220	0.633	monoatomic ion transmembrane transport
GO:0032409	0.566	regulation of transporter activity
GO:0034766	0.503	negative regulation of monoatomic ion transmembrane transport
GO:0032412	0.502	regulation of monoatomic ion transmembrane transporter activity
GO:0032410	0.495	negative regulation of transporter activity
GO:0006821	0.466	chloride transport
GO:0032413	0.396	negative regulation of ion transmembrane transporter activity
GO:0071840	0.321	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.753	intracellular anatomical structure
GO:0043229	0.722	intracellular organelle
GO:0043227	0.484	membrane-bounded organelle
GO:0043231	0.376	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	1.000	chloride(in) = chloride(out)

[back to server]