StarFunc result for job id A1E959

User Input

>input (279 residues)
MKIIILLGFLGATLSAPLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGI
LQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQ
PGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFY
AQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVF
MPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1E959	1.000	1.000	9.147E-41	279	1.000	1.000	A1E959.pdb.gz	ODAM_HUMAN Odontogenic ameloblast-associated protein OS=Homo sapiens OX=9606 GN=ODAM PE=1 SV=1
2	AFDB:A0A024RDE2	0.092	0.084	8.891E-1	314	0.165	0.146	A0A024RDE2.pdb.gz
3	AFDB:O35167	0.099	0.067	8.891E-1	458	0.172	0.105	O35167.pdb.gz	COLQ_RAT Acetylcholinesterase collagenic tail peptide OS=Rattus norvegicus OX=10116 GN=Colq PE=2 SV=1
4	AFDB:Q7KRW8	0.091	0.035	1.113	1066	0.151	0.039	Q7KRW8.pdb.gz	PRP39_DROME Pre-mRNA-processing factor 39 OS=Drosophila melanogaster OX=7227 GN=Prp39 PE=1 SV=1
5	AFDB:P49415	0.066	0.048	1.293	399	0.133	0.093	P49415.pdb.gz	SDC_DROME Syndecan OS=Drosophila melanogaster OX=7227 GN=Sdc PE=2 SV=2
6	AFDB:Q9Y5I4	0.073	0.030	1.744	1007	0.165	0.046	Q9Y5I4.pdb.gz	PCDC2_HUMAN Protocadherin alpha-C2 OS=Homo sapiens OX=9606 GN=PCDHAC2 PE=2 SV=1
7	AFDB:A0A0B4K774	0.089	0.057	2.733	477	0.140	0.082	A0A0B4K774.pdb.gz	A0A0B4K774_DROME Abelson interacting protein, isoform D OS=Drosophila melanogaster OX=7227 GN=Abi PE=1 SV=1
8	AFDB:Q9WUS4	0.132	0.085	2.733	505	0.168	0.093	Q9WUS4.pdb.gz	CXA10_MOUSE Gap junction alpha-10 protein OS=Mus musculus OX=10090 GN=Gja10 PE=1 SV=2
9	AFDB:Q21073	0.087	0.086	3.421	284	0.151	0.148	Q21073.pdb.gz	Q21073_CAEEL Glycine-rich cell wall structural protein OS=Caenorhabditis elegans OX=6239 GN=CELE_K01A6.4 PE=1 SV=1
10	AFDB:M9NDZ1	0.088	0.035	3.687	898	0.133	0.041	M9NDZ1.pdb.gz	M9NDZ1_DROME Serine-arginine protein kinase at 79D, isoform I OS=Drosophila melanogaster OX=7227 GN=Srpk79D PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1E959	0.0	548	279	1.000	1.000	ODAM_HUMAN Odontogenic ameloblast-associated protein OS=Homo sapiens OX=9606 GN=ODAM PE=1 SV=1
2	D6RA81	2.91e-175	485	253	0.907	1.000	D6RA81_HUMAN Odontogenic ameloblast-associated protein (Fragment) OS=Homo sapiens OX=9606 GN=ODAM PE=3 SV=2
3	H0YA46	3.89e-149	417	216	0.774	1.000	H0YA46_HUMAN Odontogenic ameloblast-associated protein (Fragment) OS=Homo sapiens OX=9606 GN=ODAM PE=3 SV=1
4	A1E960	9.08e-99	292	273	0.649	0.663	ODAM_MOUSE Odontogenic ameloblast-associated protein OS=Mus musculus OX=10090 GN=Odam PE=2 SV=1
5	Q3HS83	4.91e-92	275	278	0.642	0.644	ODAM_RAT Odontogenic ameloblast-associated protein OS=Rattus norvegicus OX=10116 GN=Odam PE=1 SV=1
6	Q55332	7.2	29.6	131	0.072	0.153	PSBU_SYNY3 Photosystem II extrinsic protein U OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=psbU PE=1 SV=2
7	P52889	9.6	30.0	399	0.047	0.033	LHX5_DANRE LIM/homeobox protein Lhx5 OS=Danio rerio OX=7955 GN=lhx5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11715 Nup160	1.6e+02	12.4	Nucleoporin Nup120/160
2	PF15424 ODAM	4.2e-141	480.7	Odontogenic ameloblast-associated family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379401

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341013	0.948	Amelotin
2	9606.ENSP00000313809	0.831	Ameloblastin
3	9606.ENSP00000379383	0.831	Enamelin
4	9606.ENSP00000370088	0.782	Amelogenin, X isoform
5	9606.ENSP00000318437	0.717	Follicular dendritic cell secreted peptide
6	9606.ENSP00000226444	0.688	Estrogen sulfotransferase
7	9606.ENSP00000314733	0.687	Toll-interacting protein
8	9606.ENSP00000260228	0.681	Matrix metalloproteinase-20
9	9606.ENSP00000056217	0.677	Rho guanine nucleotide exchange factor 5
10	9606.ENSP00000254801	0.660	Immunoglobulin J chain
11	9606.ENSP00000270593	0.641	Testicular acid phosphatase
12	9606.ENSP00000326159	0.635	Kallikrein-4
13	9606.ENSP00000338967	0.631	Rho GTPase-activating protein 6
14	9606.ENSP00000343172	0.612	Proline-rich protein 27
15	9606.ENSP00000420949	0.559	Uncharacterized protein C4orf36
16	9606.ENSP00000381448	0.535	Cystatin-C
17	9606.ENSP00000382213	0.527	Dentin sialophosphoprotein
18	9606.ENSP00000306361	0.518	Fibrinogen alpha chain
19	9606.ENSP00000362924	0.515	Gelsolin
20	9606.ENSP00000452780	0.515	Beta-2-microglobulin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.979	regulation of biological process
GO:0050794	0.971	regulation of cellular process
GO:0050896	0.967	response to stimulus
GO:0048856	0.955	anatomical structure development
GO:0048518	0.946	positive regulation of biological process
GO:0019222	0.936	regulation of metabolic process
GO:0042476	0.912	odontogenesis
GO:0050790	0.897	regulation of catalytic activity
GO:0060255	0.896	regulation of macromolecule metabolic process
GO:0080090	0.891	regulation of primary metabolic process
GO:0048522	0.890	positive regulation of cellular process
GO:0009893	0.888	positive regulation of metabolic process
GO:0051171	0.881	regulation of nitrogen compound metabolic process
GO:0031323	0.872	regulation of cellular metabolic process
GO:0006950	0.844	response to stress
GO:0010468	0.840	regulation of gene expression
GO:0044093	0.828	positive regulation of molecular function
GO:0010604	0.817	positive regulation of macromolecule metabolic process
GO:0051246	0.809	regulation of protein metabolic process
GO:0051128	0.778	regulation of cellular component organization
GO:0043085	0.767	positive regulation of catalytic activity
GO:0051336	0.739	regulation of hydrolase activity
GO:0006952	0.696	defense response
GO:0051173	0.658	positive regulation of nitrogen compound metabolic process
GO:0031325	0.658	positive regulation of cellular metabolic process
GO:0009987	0.641	cellular process
GO:0051247	0.485	positive regulation of protein metabolic process
GO:0001932	0.483	regulation of protein phosphorylation
GO:0033043	0.450	regulation of organelle organization
GO:0051345	0.362	positive regulation of hydrolase activity
GO:0042327	0.337	positive regulation of phosphorylation
GO:0051493	0.316	regulation of cytoskeleton organization
GO:0001934	0.316	positive regulation of protein phosphorylation
GO:0042475	0.310	odontogenesis of dentin-containing tooth
GO:0009611	0.303	response to wounding
GO:0032970	0.303	regulation of actin filament-based process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0005829	0.998	cytosol
GO:0070013	0.998	intracellular organelle lumen
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005654	0.992	nucleoplasm
GO:0005576	0.990	extracellular region
GO:0072686	0.988	mitotic spindle
GO:0071944	0.942	cell periphery
GO:0005615	0.851	extracellular space
GO:0012505	0.823	endomembrane system
GO:0099080	0.318	supramolecular complex
GO:0099081	0.308	supramolecular polymer

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]