StarFunc result for job id A1IGU5

User Input

>input (675 residues)
MAKHGADEPSSRSGSPDREGRASEDRSLLHQRLAVRELIDTEVSYLHMLQLCASDIRSRL
QQLPQGDLDVLFSNIDDIIKVNSRFLHDLQETASKEEEQVQLVGNIFLEFQEELEQVYKV
YCASYDQALLLVDTYRKEPELQRHIQGIVEAVVPQAGSSGLSFLLVIPLQRITRYPLLLQ
KILENTVPDASAYPVLQRAVSALQDVNTNINEYKMRKEVASKYTKVEQLTLRERLARINT
HTLSKKTTRLSQLLKQEAGLIPRTEDKEFDDLEERFQWVSLCVTELKNNVAAYLDNLQAF
LYFRPHEYNLDIPEGPAVQYCNLARDLHLEAFLKFKQRLEGLVWQPLCSLAKALLGPQNL
IKKRLDKLLDFERVEEKLLEVGSVTYQEEAARHTYQALNSLLVAELPQFNQLVMQWLGQI
MCTFVTLQRDLAKQVLQRAEGSMAQLPHHHVPEPAFRKLVEDALGRTSNQLRSFQETFEK
VQPPPTTQPLLPGSERQVQALLSRYGPGKLYQVTSNISGTGTLDLTLPRGQIVAILQNKD
TKGNSGRWLVDTGGHRGYVPAGKLQLYHVVPSAEELRRQAGLNKDPRCLTPEPSPALVPS
IPTMNQVIAAYPFVARSSHEVSLQAGQPVTILEAQDKKGNPEWSLVEVNGQRGYVPSGFL
ARARSPVLWGWSLPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NXL2	0.534	0.473	4.374E-38	777	0.307	0.266	Q9NXL2.pdb.gz	ARH38_HUMAN Rho guanine nucleotide exchange factor 38 OS=Homo sapiens OX=9606 GN=ARHGEF38 PE=1 SV=2
2	AFDB:E2RP94	0.579	0.261	3.630E-36	1583	0.317	0.135	E2RP94.pdb.gz	DNMBP_CANLF Dynamin-binding protein OS=Canis lupus familiaris OX=9615 GN=DNMBP PE=3 SV=2
3	AFDB:Q6XZF7	0.600	0.269	2.694E-35	1577	0.317	0.136	Q6XZF7.pdb.gz	DNMBP_HUMAN Dynamin-binding protein OS=Homo sapiens OX=9606 GN=DNMBP PE=1 SV=1
4	AFDB:Q6TXD4	0.593	0.266	2.819E-35	1580	0.307	0.131	Q6TXD4.pdb.gz	DNMBP_MOUSE Dynamin-binding protein OS=Mus musculus OX=10090 GN=Dnmbp PE=1 SV=2
5	AFDB:E7F1U2	0.579	0.250	7.012E-35	1673	0.329	0.133	E7F1U2.pdb.gz	DNMBP_DANRE Dynamin-binding protein OS=Danio rerio OX=7955 GN=dnmbp PE=2 SV=1
6	AFDB:M0R4F8	0.588	0.268	8.039E-35	1577	0.308	0.132	M0R4F8.pdb.gz	DNMBP_RAT Dynamin-binding protein OS=Rattus norvegicus OX=10116 GN=Dnmbp PE=1 SV=2
7	AFDB:G5ECK4	0.489	0.237	1.256E-19	1523	0.200	0.089	G5ECK4.pdb.gz	G5ECK4_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnbp-1 PE=1 SV=1
8	AFDB:O59679	0.481	0.598	8.613E-14	525	0.124	0.160	O59679.pdb.gz	GEF3_SCHPO Rho guanine nucleotide exchange factor gef3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gef3 PE=4 SV=1
9	AFDB:O74352	0.268	0.367	4.627E-11	466	0.127	0.185	O74352.pdb.gz	HOB1_SCHPO Protein hob1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hob1 PE=1 SV=1
10	AFDB:P52735	0.282	0.220	2.734E-10	878	0.175	0.134	P52735.pdb.gz	VAV2_HUMAN Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2 PE=1 SV=2
11	PDB:4mt6A	0.262	0.441	1.074E-7	389	0.080	0.139	4mt6A.pdb.gz
12	PDB:7rx9A	0.269	0.413	3.063E-7	432	0.090	0.141	7rx9A.pdb.gz
13	PDB:2lqnA	0.080	0.171	3.659E-5	303	0.049	0.109	2lqnA.pdb.gz
14	PDB:1griA	0.084	0.258	1.465E-3	211	0.044	0.142	1griA.pdb.gz
15	PDB:4gouA	0.233	0.306	1.533E-3	507	0.068	0.091	4gouA.pdb.gz
16	PDB:2eyzA	0.080	0.170	1.680E-3	304	0.052	0.115	2eyzA.pdb.gz
17	PDB:3qwyA	0.082	0.310	6.294E-3	170	0.034	0.135	3qwyA.pdb.gz
18	PDB:1k9aB	0.082	0.124	2.254E-2	441	0.022	0.034	1k9aB.pdb.gz
19	PDB:2dybA	0.081	0.177	2.359E-2	298	0.021	0.047	2dybA.pdb.gz
20	PDB:3ehqA	0.082	0.284	3.100E-2	182	0.021	0.077	3ehqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NXL2	4.47e-81	275	777	0.311	0.270	ARH38_HUMAN Rho guanine nucleotide exchange factor 38 OS=Homo sapiens OX=9606 GN=ARHGEF38 PE=1 SV=2
2	E7F1U2	3.20e-79	278	1673	0.276	0.111	DNMBP_DANRE Dynamin-binding protein OS=Danio rerio OX=7955 GN=dnmbp PE=2 SV=1
3	E2RP94	2.90e-73	260	1583	0.259	0.111	DNMBP_CANLF Dynamin-binding protein OS=Canis lupus familiaris OX=9615 GN=DNMBP PE=3 SV=2
4	M0R4F8	2.42e-72	257	1577	0.259	0.111	DNMBP_RAT Dynamin-binding protein OS=Rattus norvegicus OX=10116 GN=Dnmbp PE=1 SV=2
5	Q6TXD4	9.38e-72	256	1580	0.261	0.111	DNMBP_MOUSE Dynamin-binding protein OS=Mus musculus OX=10090 GN=Dnmbp PE=1 SV=2
6	Q6XZF7	5.95e-71	253	1577	0.259	0.111	DNMBP_HUMAN Dynamin-binding protein OS=Homo sapiens OX=9606 GN=DNMBP PE=1 SV=1
7	Q8TCU6	1.53e-20	99.4	1659	0.111	0.045	PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens OX=9606 GN=PREX1 PE=1 SV=3
8	G5ECK4	2.31e-20	99.0	1523	0.147	0.065	G5ECK4_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnbp-1 PE=1 SV=1
9	F1R6J2	3.25e-19	95.1	1622	0.093	0.039	F1R6J2_DANRE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Danio rerio OX=7955 GN=prex1 PE=1 SV=1
10	Q69ZK0	3.86e-18	91.7	1650	0.121	0.050	PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus OX=10090 GN=Prex1 PE=1 SV=2
11	D3ZS72	9.33e-18	90.5	1635	0.104	0.043	D3ZS72_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=1 SV=4
12	A0A8I6GLR6	1.00e-17	90.5	1646	0.104	0.043	A0A8I6GLR6_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=4 SV=1
13	A0A024RDM6	3.56e-17	87.8	652	0.083	0.086	A0A024RDM6_HUMAN SPATA13 (Fragment) OS=Homo sapiens OX=9606 GN=SPATA13 PE=4 SV=1
14	Q96N96	3.56e-17	87.8	652	0.083	0.086	SPT13_HUMAN Spermatogenesis-associated protein 13 OS=Homo sapiens OX=9606 GN=SPATA13 PE=1 SV=1
15	Q70Z35	3.45e-16	85.5	1606	0.096	0.040	PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens OX=9606 GN=PREX2 PE=1 SV=1
16	A0A5F9ZI31	1.69e-15	81.6	451	0.081	0.122	A0A5F9ZI31_HUMAN Cdc42 guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
17	Q54YZ6	1.95e-15	82.8	1218	0.099	0.055	Q54YZ6_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=gxcA PE=4 SV=1
18	A0A0A6YYF8	2.09e-15	82.0	564	0.081	0.098	A0A0A6YYF8_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
19	F1Q628	2.09e-15	82.0	514	0.079	0.103	F1Q628_DANRE Rho guanine nucleotide exchange factor 9 OS=Danio rerio OX=7955 GN=arhgef9 PE=4 SV=1
20	Q3LAC4	2.10e-15	82.8	1598	0.089	0.038	PREX2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Mus musculus OX=10090 GN=Prex2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03114 BAR	4.8e-09	47.8	BAR domain
2	PF13319 DUF4090	5e+02	12.4	Protein of unknown function (DUF4090)
3	PF08336 P4Ha_N	8.5e+02	11.2	Prolyl 4-Hydroxylase alpha-subunit, N-terminal region
4	PF00621 RhoGEF	5.1e-32	123.1	RhoGEF domain
5	PF00018 SH3_1	1.6e-07	42.1	SH3 domain
6	PF17902 SH3_10	3.7e+02	12.6	SH3 domain
7	PF07653 SH3_2	1.4e-10	52.1	Variant SH3 domain
8	PF08239 SH3_3	0.00074	31.2	Bacterial SH3 domain
9	PF14604 SH3_9	2.3e-08	45.2	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000328083

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367355	0.650	Rho guanine nucleotide exchange factor 35
2	9606.ENSP00000298815	0.625	Rho GTPase-activating protein 42
3	9606.ENSP00000298694	0.589	Rho guanine nucleotide exchange factor 40
4	9606.ENSP00000469205	0.588	SLIT and NTRK-like protein 4
5	9606.ENSP00000356992	0.567	Rho GTPase-activating protein 30
6	9606.ENSP00000377380	0.567	Rho GTPase-activating protein 9
7	9606.ENSP00000368994	0.552	Rho GTPase-activating protein 44
8	9606.ENSP00000225525	0.542	Tax1-binding protein 3
9	9606.ENSP00000276416	0.533	Bridging integrator 3
10	9606.ENSP00000363349	0.528	Sorting nexin-30
11	9606.ENSP00000218008	0.520	Protein ATP1B4
12	9606.ENSP00000274710	0.516	Pleckstrin and Sec7 domain containing 2
13	9606.ENSP00000355060	0.514	Rho guanine nucleotide exchange factor 10-like protein
14	9606.ENSP00000348828	0.502	Rho guanine nucleotide exchange factor 26

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030695	0.996	GTPase regulator activity
GO:0140677	0.990	molecular function activator activity
GO:0005085	0.982	guanyl-nucleotide exchange factor activity
GO:0019899	0.423	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.999	biological regulation
GO:0009987	0.991	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0050896	0.604	response to stimulus
GO:0048583	0.525	regulation of response to stimulus
GO:0023051	0.421	regulation of signaling
GO:0010646	0.420	regulation of cell communication
GO:0051716	0.416	cellular response to stimulus
GO:0009966	0.414	regulation of signal transduction
GO:0051056	0.395	regulation of small GTPase mediated signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0071944	0.947	cell periphery
GO:0016020	0.758	membrane
GO:0043226	0.722	organelle
GO:0005886	0.665	plasma membrane
GO:0043229	0.662	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]