StarFunc result for job id A1KXE4

User Input

>input (195 residues)
MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPAYSPNMYPGANPTFQTGYTPGTPYK
VSCSPTSGAVPPYSSSPNPYQTAVYPVRSAYPQQSPYAQQGTYYTQPLYAAPPHVIHHTT
VVQPNGMPATVYPAPIPPPRGNGVTMGMVAGTTMAMSAGTLLTAHSPTPVAPHPVTVPTY
RAPGTPTYSYVPPQW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1KXE4	1.000	1.000	1.529E-30	195	1.000	1.000	A1KXE4.pdb.gz	F168B_HUMAN Myelin-associated neurite-outgrowth inhibitor OS=Homo sapiens OX=9606 GN=FAM168B PE=1 SV=1
2	AFDB:A0A2R8Q9B9	0.122	0.095	2.458	305	0.174	0.111	A0A2R8Q9B9.pdb.gz
3	AFDB:Q93VA8	0.094	0.061	3.522	350	0.195	0.109	Q93VA8.pdb.gz	Q93VA8_ARATH Alba DNA/RNA-binding protein OS=Arabidopsis thaliana OX=3702 GN=ALBA1 PE=1 SV=1
4	AFDB:Q9VE13	0.125	0.020	4.697	1788	0.215	0.023	Q9VE13.pdb.gz	Q9VE13_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=gukh PE=1 SV=3
5	AFDB:D3YYY8	0.087	0.028	5.423	869	0.179	0.040	D3YYY8.pdb.gz	D3YYY8_MOUSE Rho guanine nucleotide exchange factor (GEF) 26 OS=Mus musculus OX=10090 GN=Arhgef26 PE=1 SV=1
6	AFDB:Q9VV52	0.071	0.024	6.263	1117	0.226	0.039	Q9VV52.pdb.gz	Q9VV52_DROME LD37257p OS=Drosophila melanogaster OX=7227 GN=RAF2 PE=1 SV=3
7	AFDB:Q9D0P5	0.107	0.071	7.231	417	0.169	0.079	Q9D0P5.pdb.gz	PYGO1_MOUSE Pygopus homolog 1 OS=Mus musculus OX=10090 GN=Pygo1 PE=1 SV=1
8	AFDB:Q67YI6	0.083	0.068	8.350	411	0.128	0.061	Q67YI6.pdb.gz	ATL65_ARATH RING-H2 finger protein ATL65 OS=Arabidopsis thaliana OX=3702 GN=ATL65 PE=2 SV=2
9	AFDB:P57682	0.089	0.062	8.973	345	0.179	0.101	P57682.pdb.gz	KLF3_HUMAN Krueppel-like factor 3 OS=Homo sapiens OX=9606 GN=KLF3 PE=1 SV=1
10	AFDB:P23825	0.104	0.053	9.642	444	0.226	0.099	P23825.pdb.gz	GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus OX=9031 GN=GATA3 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1KXE4	4.98e-130	365	195	1.000	1.000	F168B_HUMAN Myelin-associated neurite-outgrowth inhibitor OS=Homo sapiens OX=9606 GN=FAM168B PE=1 SV=1
2	Q92567	1.17e-52	170	244	0.667	0.533	F168A_HUMAN Protein FAM168A OS=Homo sapiens OX=9606 GN=FAM168A PE=1 SV=2
3	Q9VC64	0.033	37.0	1729	0.215	0.024	Q9VC64_DROME Anastral spindle 1, isoform A OS=Drosophila melanogaster OX=7227 GN=ana1 PE=1 SV=1
4	Q6KC79	0.24	34.7	2804	0.118	0.008	NIPBL_HUMAN Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL PE=1 SV=2
5	Q6KCD5	0.24	34.7	2798	0.118	0.008	NIPBL_MOUSE Nipped-B-like protein OS=Mus musculus OX=10090 GN=Nipbl PE=1 SV=1
6	A0A590UJS4	0.25	34.3	2649	0.118	0.009	A0A590UJS4_HUMAN Nipped-B protein OS=Homo sapiens OX=9606 GN=NIPBL PE=1 SV=1
7	Q1XG42	0.32	34.3	2949	0.113	0.007	Q1XG42_XENLA Nipped-B protein OS=Xenopus laevis OX=8355 GN=nipbl.L PE=2 SV=1
8	O14776	1.4	32.0	1098	0.231	0.041	TCRG1_HUMAN Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1 PE=1 SV=2
9	Q96ST3	1.5	32.0	1273	0.190	0.029	SIN3A_HUMAN Paired amphipathic helix protein Sin3a OS=Homo sapiens OX=9606 GN=SIN3A PE=1 SV=2
10	G5EEE0	2.4	31.6	1305	0.144	0.021	G5EEE0_CAEEL Rap guanine nucleotide exchange factor 2 OS=Caenorhabditis elegans OX=6239 GN=pxf-1 PE=1 SV=1
11	Q9VB05	2.5	31.2	836	0.174	0.041	Q9VB05_DROME ALG-2 interacting protein X OS=Drosophila melanogaster OX=7227 GN=ALiX PE=1 SV=1
12	P27715	3.1	31.2	2155	0.082	0.007	UNC13_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans OX=6239 GN=unc-13 PE=1 SV=4
13	E7EX73	3.3	30.8	1436	0.221	0.030	E7EX73_HUMAN Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=1
14	G5EGS5	5.9	30.0	1975	0.087	0.009	GBF1_CAEEL Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 homolog OS=Caenorhabditis elegans OX=6239 GN=gbf-1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14944 TCRP1	2.1e-102	353.8	Tongue Cancer Chemotherapy Resistant Protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008578053.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008573616.1	0.890	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 95% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
2	482537.XP_008573196.1	0.773	Serine/arginine repetitive matrix protein 1 isoform X1
3	482537.XP_008591348.1	0.670	WD repeat and SOCS box-containing protein 2
4	482537.XP_008588816.1	0.662	Signal recognition particle subunit SRP72
5	482537.XP_008572345.1	0.598	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 6 Proteins, and 93% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
6	482537.XP_008587279.1	0.555	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 21 mRNAs, 15 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
7	482537.XP_008577057.1	0.549	Reticulon-4 isoform X1
8	482537.XP_008590971.1	0.523	Reticulon-4 receptor
9	482537.XP_008571264.1	0.513	Repulsive guidance molecule A
10	482537.XP_008591635.1	0.513	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 27 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048583	0.993	regulation of response to stimulus
GO:0048522	0.990	positive regulation of cellular process
GO:0048584	0.984	positive regulation of response to stimulus
GO:0051171	0.972	regulation of nitrogen compound metabolic process
GO:0080090	0.971	regulation of primary metabolic process
GO:0060255	0.970	regulation of macromolecule metabolic process
GO:0031323	0.954	regulation of cellular metabolic process
GO:0010604	0.949	positive regulation of macromolecule metabolic process
GO:0019219	0.941	regulation of nucleobase-containing compound metabolic process
GO:0051173	0.928	positive regulation of nitrogen compound metabolic process
GO:0031325	0.927	positive regulation of cellular metabolic process
GO:0080135	0.917	regulation of cellular response to stress
GO:0051052	0.834	regulation of DNA metabolic process
GO:2001020	0.812	regulation of response to DNA damage stimulus
GO:0009987	0.703	cellular process
GO:0045935	0.695	positive regulation of nucleobase-containing compound metabolic process
GO:2001022	0.468	positive regulation of response to DNA damage stimulus
GO:0006282	0.422	regulation of DNA repair
GO:0051054	0.415	positive regulation of DNA metabolic process
GO:0045739	0.410	positive regulation of DNA repair

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070062	0.997	extracellular exosome
GO:0005829	0.909	cytosol
GO:0043231	0.751	intracellular membrane-bounded organelle
GO:0031981	0.322	nuclear lumen
GO:0005654	0.302	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]