StarFunc result for job id A1KZ92

User Input

>input (1463 residues)
MEPRLFCWTTLFLLAGWCLPGLPCPSRCLCFKSTVRCMHLMLDHIPQVPQQTTVLDLRFN
RIREIPGSAFKKLKNLNTLLLNNNHIRKISRNAFEGLENLLYLYLYKNEIHALDKQTFKG
LISLEHLYIHFNQLEMLQPETFGDLLRLERLFLHNNKLSKIPAGSFSNLDSLKRLRLDSN
ALVCDCDLMWLGELLQGFAQHGHTQAAATCEYPRRLHGRAVASVTVEEFNCQSPRITFEP
QDVEVPSGNTVYFTCRAEGNPKPEIIWIHNNHSLDLEDDTRLNVFDDGTLMIRNTRESDQ
GVYQCMARNSAGEAKTQSAMLRYSSLPAKPSFVIQPQDTEVLIGTSTTLECMATGHPHPL
ITWTRDNGLELDGSRHVATSSGLYLQNITQRDHGRFTCHANNSHGTVQAAANIIVQAPPQ
FTVTPKDQVVLEEHAVEWLCEADGNPPPVIVWTKTGGQLPVEGQHTVLSSGTLRIDRAAQ
HDQGQYECQAVSSLGVKKVSVQLTVKPKALAVFTQLPQDTSVEVGKNINISCHAQGEPQP
IITWNKEGVQITESGKFHVDDEGTLTIYDAGFPDQGRYECVARNSFGLAVTNMFLTVTAI
QGRQAGDDFVESSILDAVQRVDSAINSTRRHLFSQKPHTSSDLLAQFHYPRDPLIVEMAR
AGEIFEHTLQLIRERVKQGLTVDLEGKEFRYNDLVSPRSLSLIANLSGCTARRPLPNCSN
RCFHAKYRAHDGTCNNLQQPTWGAALTAFARLLQPAYRDGIRAPRGLGLPVGSRQPLPPP
RLVATVWARAAAVTPDHSYTRMLMHWGWFLEHDLDHTVPALSTARFSDGRPCSSVCTNDP
PCFPMNTRHADPRGTHAPCMLFARSSPACASGRPSATVDSVYAREQINQQTAYIDGSNVY
GSSERESQALRDPSVPRGLLKTGFPWPPSGKPLLPFSTGPPTECARQEQESPCFLAGDHR
ANEHLALAAMHTLWFREHNRMATELSALNPHWEGNTVYQEARKIVGAELQHITYSHWLPK
VLGDPGTRMLRGYRGYNPNVNAGIINSFATAAFRFGHTLINPILYRLNATLGEISEGHLP
FHKALFSPSRIIKEGGIDPVLRGLFGVAAKWRAPSYLLSPELTQRLFSAAYSAAVDSAAT
IIQRGRDHGIPPYVDFRVFCNLTSVKNFEDLQNEIKDSEIRQKLRKLYGSPGDIDLWPAL
MVEDLIPGTRVGPTLMCLFVTQFQRLRDGDRFWYENPGVFTPAQLTQLKQASLSRVLCDN
GDSIQQVQADVFVKAEYPQDYLNCSEIPKVDLRVWQDCCADCRSRGQFRAVTQESQKKRS
AQYSYPVDKDMELSHLRSRQQDKIYVGEDARNVTVLAKTKFSQDFSTFAAEIQETITALR
EQINKLEARLRQAGCTDVRGVPRKAEERWMKEDCTHCICESGQVTCVVEICPPAPCPSPE
LVKGTCCPVCRDRGMPSDSPEKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2KHM6	0.480	0.481	0.000	1460	0.582	0.583	A0A0G2KHM6.pdb.gz
2	AFDB:G5EG78	0.495	0.539	0.000	1328	0.290	0.320	G5EG78.pdb.gz	PXDN2_CAEEL Peroxidasin homolog pxn-2 OS=Caenorhabditis elegans OX=6239 GN=pxn-2 PE=1 SV=1
3	AFDB:Q1ENI8	0.458	0.518	0.000	1285	0.301	0.342	Q1ENI8.pdb.gz	PXDN1_CAEEL Peroxidasin homolog pxn-1 OS=Caenorhabditis elegans OX=6239 GN=pxn-1 PE=1 SV=1
4	AFDB:Q92626	0.470	0.466	0.000	1479	0.604	0.597	Q92626.pdb.gz	PXDN_HUMAN Peroxidasin homolog OS=Homo sapiens OX=9606 GN=PXDN PE=1 SV=2
5	AFDB:Q9VZZ4	0.465	0.446	0.000	1527	0.386	0.370	Q9VZZ4.pdb.gz	PXDN_DROME Peroxidasin OS=Drosophila melanogaster OX=7227 GN=Pxn PE=1 SV=1
6	AFDB:P14650	0.446	0.707	2.011E-69	914	0.193	0.309	P14650.pdb.gz	PERT_RAT Thyroid peroxidase OS=Rattus norvegicus OX=10116 GN=Tpo PE=2 SV=1
7	AFDB:C9DTM6	0.456	0.850	1.654E-68	771	0.180	0.342	C9DTM6.pdb.gz	C9DTM6_ICTPU Eosinophil peroxidase precursor OS=Ictalurus punctatus OX=7998 GN=mpx PE=2 SV=1
8	AFDB:P09933	0.452	0.707	2.800E-68	926	0.197	0.311	P09933.pdb.gz	PERT_PIG Thyroid peroxidase OS=Sus scrofa OX=9823 GN=TPO PE=1 SV=1
9	AFDB:F1R9R1	0.455	0.738	1.045E-67	893	0.191	0.312	F1R9R1.pdb.gz
10	AFDB:P07202	0.454	0.704	1.045E-67	933	0.188	0.295	P07202.pdb.gz	PERT_HUMAN Thyroid peroxidase OS=Homo sapiens OX=9606 GN=TPO PE=1 SV=4
11	PDB:5mfaA	0.380	0.928	2.824E-58	588	0.163	0.406	5mfaA.pdb.gz	Structure of human promyeloperoxidase (proMPO) and the role of the propeptide in processing and maturation.
12	PDB:4hhrA	0.304	0.660	4.806E-23	640	0.079	0.181	4hhrA.pdb.gz	The crystal structure of alpha-Dioxygenase provides insight into diversity in the cyclooxygenase-peroxidase superfamily.
13	PDB:5oj2B	0.113	0.216	2.498E-21	692	0.055	0.116	5oj2B.pdb.gz
14	PDB:5f1aA	0.254	0.638	3.586E-18	553	0.063	0.166	5f1aA.pdb.gz	Crystal Structure of Aspirin-Acetylated Human Cyclooxygenase-2: Insight into the Formation of Products with Reversed Stereochemistry.
15	PDB:4rs0A	0.257	0.631	1.143E-17	557	0.070	0.183	4rs0A.pdb.gz	Action at a Distance: MUTATIONS OF PERIPHERAL RESIDUES TRANSFORM RAPID REVERSIBLE INHIBITORS TO SLOW, TIGHT BINDERS OF CYCLOOXYGENASE-2.
16	PDB:6dldD	0.086	0.322	4.994E-17	269	0.043	0.234	6dldD.pdb.gz
17	PDB:6y3cA	0.246	0.604	8.023E-17	557	0.059	0.154	6y3cA.pdb.gz
18	PDB:1e07A	0.110	0.216	2.071E-16	642	0.053	0.121	1e07A.pdb.gz
19	PDB:5y31B	0.112	0.297	4.884E-15	511	0.068	0.194	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
20	PDB:6dlfA	0.101	0.448	1.076E-14	236	0.037	0.229	6dlfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G5EG78	0.0	644	1328	0.240	0.264	PXDN2_CAEEL Peroxidasin homolog pxn-2 OS=Caenorhabditis elegans OX=6239 GN=pxn-2 PE=1 SV=1
2	Q1ENI8	0.0	684	1285	0.247	0.281	PXDN1_CAEEL Peroxidasin homolog pxn-1 OS=Caenorhabditis elegans OX=6239 GN=pxn-1 PE=1 SV=1
3	Q3UQ28	0.0	1812	1475	0.606	0.601	PXDN_MOUSE Peroxidasin homolog OS=Mus musculus OX=10090 GN=Pxdn PE=1 SV=2
4	Q92626	0.0	1813	1479	0.607	0.600	PXDN_HUMAN Peroxidasin homolog OS=Homo sapiens OX=9606 GN=PXDN PE=1 SV=2
5	Q9VZZ4	0.0	1029	1527	0.398	0.382	PXDN_DROME Peroxidasin OS=Drosophila melanogaster OX=7227 GN=Pxn PE=1 SV=1
6	P09933	3.50e-154	493	926	0.198	0.313	PERT_PIG Thyroid peroxidase OS=Sus scrofa OX=9823 GN=TPO PE=1 SV=1
7	P14650	5.67e-154	493	914	0.193	0.309	PERT_RAT Thyroid peroxidase OS=Rattus norvegicus OX=10116 GN=Tpo PE=2 SV=1
8	P35419	1.07e-152	489	914	0.192	0.307	PERT_MOUSE Thyroid peroxidase OS=Mus musculus OX=10090 GN=Tpo PE=2 SV=1
9	P11678	1.08e-142	456	715	0.186	0.380	PERE_HUMAN Eosinophil peroxidase OS=Homo sapiens OX=9606 GN=EPX PE=1 SV=2
10	P49290	1.82e-142	455	716	0.192	0.392	PERE_MOUSE Eosinophil peroxidase OS=Mus musculus OX=10090 GN=Epx PE=1 SV=2
11	F1Q944	1.91e-142	457	762	0.188	0.361	F1Q944_DANRE Eosinophil peroxidase isoform 2 precursor OS=Danio rerio OX=7955 GN=drf PE=1 SV=1
12	P07202	1.19e-141	460	933	0.185	0.289	PERT_HUMAN Thyroid peroxidase OS=Homo sapiens OX=9606 GN=TPO PE=1 SV=4
13	Q90XS6	9.15e-141	452	762	0.186	0.357	Q90XS6_DANRE Myeloperoxidase OS=Danio rerio OX=7955 GN=mpx PE=2 SV=1
14	C9DTM6	6.98e-138	445	771	0.180	0.341	C9DTM6_ICTPU Eosinophil peroxidase precursor OS=Ictalurus punctatus OX=7998 GN=mpx PE=2 SV=1
15	P05164	3.74e-136	439	745	0.182	0.357	PERM_HUMAN Myeloperoxidase OS=Homo sapiens OX=9606 GN=MPO PE=1 SV=1
16	P11247	1.41e-135	437	718	0.177	0.361	PERM_MOUSE Myeloperoxidase OS=Mus musculus OX=10090 GN=Mpo PE=1 SV=2
17	A0A0G2K1A2	1.32e-131	426	719	0.176	0.359	A0A0G2K1A2_RAT Myeloperoxidase OS=Rattus norvegicus OX=10116 GN=Mpo PE=1 SV=2
18	Q8R481	6.08e-125	408	710	0.170	0.351	PERL_MESAU Lactoperoxidase OS=Mesocricetus auratus OX=10036 GN=LPO PE=1 SV=1
19	Q5SW46	1.06e-124	407	710	0.176	0.362	PERL_MOUSE Lactoperoxidase OS=Mus musculus OX=10090 GN=Lpo PE=1 SV=1
20	P22079	1.39e-124	407	712	0.178	0.365	PERL_HUMAN Lactoperoxidase OS=Homo sapiens OX=9606 GN=LPO PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14828 Amnionless	6.7e+02	10.4	Amnionless
2	PF03098 An_peroxidase	2e-173	589.4	Animal haem peroxidase
3	PF08205 C2-set_2	2.8e-09	48.2	CD80-like C2-set immunoglobulin domain
4	PF02120 Flg_hook	1.1e+02	14.1	Flagellar hook-length control protein FliK
5	PF07679 I-set	1.7e-74	257.2	Immunoglobulin I-set domain
6	PF00047 ig	8.1e-36	133.4	Immunoglobulin domain
7	PF13895 Ig_2	8e-38	139.9	Immunoglobulin domain
8	PF13927 Ig_3	1.7e-64	225.7	Immunoglobulin domain
9	PF16680 Ig_4	0.002	30.0	T-cell surface glycoprotein CD3 delta chain
10	PF17736 Ig_C17orf99	1.6e-05	36.2	C17orf99 Ig domain
11	PF12799 LRR_4	6.5e-10	50.3	Leucine Rich repeats (2 copies)
12	PF13306 LRR_5	1e-06	40.2	BspA type Leucine rich repeat region (6 copies)
13	PF13855 LRR_8	6.7e-25	97.9	Leucine rich repeat
14	PF14580 LRR_9	0.0077	27.3	Leucine-rich repeat
15	PF05825 PSP94	3.7	19.5	Beta-microseminoprotein (PSP-94)
16	PF12714 TILa	0.26	22.6	TILa domain
17	PF07686 V-set	1.6e-12	59.0	Immunoglobulin V-set domain
18	PF00093 VWC	0.0017	30.0	von Willebrand factor type C domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010367449.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010368587.1	0.535	Collagen alpha-2(V) chain isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016684	0.996	oxidoreductase activity, acting on peroxide as acceptor
GO:0016209	0.948	antioxidant activity
GO:0004601	0.935	peroxidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016043	0.996	cellular component organization
GO:0045229	0.989	external encapsulating structure organization
GO:0043062	0.975	extracellular structure organization
GO:0030198	0.972	extracellular matrix organization
GO:0044085	0.621	cellular component biogenesis
GO:0022607	0.612	cellular component assembly
GO:0008152	0.490	metabolic process
GO:0065007	0.474	biological regulation
GO:0085029	0.472	extracellular matrix assembly
GO:0032502	0.466	developmental process
GO:0048856	0.449	anatomical structure development
GO:0032501	0.416	multicellular organismal process
GO:0050794	0.355	regulation of cellular process
GO:0007275	0.349	multicellular organism development
GO:0071704	0.329	organic substance metabolic process
GO:0050896	0.315	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031012	0.998	extracellular matrix
GO:0062023	0.990	collagen-containing extracellular matrix
GO:0005576	0.931	extracellular region
GO:0005615	0.700	extracellular space
GO:0070013	0.329	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.11.-.-	0.996	Acting on a peroxide as acceptor.
EC:1.11.1.-	0.935	Peroxidases.

[back to server]