StarFunc result for job id A1L390

User Input

>input (1219 residues)
MPVSTSLHQDGSQERPVSLTSTTSSSGSSCDSRSAMEEPSSSEAPAKNGAGSLRSRHLPN
SNNNSSSWLNVKGPLSPFNSRAAAGPAHHKLSYLGRVVREIVETERMYVQDLRSIVEDYL
LKIIDTPGLLKPEQVSALFGNIENIYALNSQLLRDLDSCNSDPVAVASCFVERSQEFDIY
TQYCNNYPNSVAALTECMRDKQQAKFFRDRQELLQHSLPLGSYLLKPVQRILKYHLLLQE
IAKHFDEEEDGFEVVEDAIDTMTCVAWYINDMKRRHEHAVRLQEIQSLLINWKGPDLTTY
GELVLEGTFRVHRVRNERTFFLFDKTLLITKKRGDHFVYKGNIPCSSLMLIESTRDSLCF
TVTHYKHSKQQYSIQAKTVEEKRNWTHHIKRLILENHHATIPQKAKEAILEMDSYYPNRY
RCSPERLKKAWSSQDEVSTNVRQGRRQSEPTKHLLRQLNEKARAAGMKGKGRRESESSRS
SRRPSGRSPTSTEKRMSFESISSLPEVEPDPEAGSEQEVFSAVEGPSAEETPSDTESPEV
LETQLDAHQGLLGMDPPGDMVDFVAAESTEDLKALSSEEEEEMGGAAQEPESLLPPSVLD
QASVIAERFVSSFSRRSSVAQEDSKSSGFGSPRLVSRSSSVLSLEGSEKGLARHGSATDS
LSCQLSPEVDISVGVATEDSPSVNGMEPPSPGCPVEPDRSSCKKKESALSTRDRLLLDKI
KSYYENAEHHDAGFSVRRRESLSYIPKGLVRNSISRFNSLPRPDPEPVPPVGSKRQVGSR
PTSWALFELPGPSQAVKGDPPPISDAEFRPSSEIVKIWEGMESSGGSPGKGPGQGQANGF
DLHEPLFILEEHELGAITEESATASPESSSPTEGRSPAHLARELKELVKELSSSTQGELV
APLHPRIVQLSHVMDSHVSERVKNKVYQLARQYSLRIKSNKPVMARPPLQWEKVAPERDG
KSPTVPCLQEEAGEPLGGKGKRKPVLSLFDYEQLMAQEHSPPKPSSAGEMSPQRFFFNPS
AVSQRTTSPGGRPSARSPLSPTETFSWPDVRELCSKYASRDEARRAGGGRPRGPPVNRSH
SVPENMVEPPLSGRVGRCRSLSTKRGRGGGEAAQSPGPLPQSKPDGGETLYVTADLTLED
NRRVIVMEKGPLPSPTAGLEESSGQGPSSPVALLGQVQDFQQSAECQPKEEGSRDPADPS
QQGRVRNLREKFQALNSVG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1L390	0.999	0.999	0.000	1219	1.000	1.000	A1L390.pdb.gz	PKHG3_HUMAN Pleckstrin homology domain-containing family G member 3 OS=Homo sapiens OX=9606 GN=PLEKHG3 PE=1 SV=1
2	AFDB:Q9H7P9	0.268	0.237	6.430E-43	1386	0.277	0.244	Q9H7P9.pdb.gz	PKHG2_HUMAN Pleckstrin homology domain-containing family G member 2 OS=Homo sapiens OX=9606 GN=PLEKHG2 PE=1 SV=3
3	PDB:4mt6A	0.201	0.524	1.366E-21	389	0.080	0.249	4mt6A.pdb.gz
4	PDB:7rx9A	0.143	0.395	1.968E-21	432	0.080	0.227	7rx9A.pdb.gz
5	AFDB:Q54DW7	0.245	0.299	3.654E-21	986	0.144	0.178	Q54DW7.pdb.gz	Q54DW7_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcU PE=4 SV=1
6	AFDB:A8DZ19	0.178	0.167	8.261E-19	1310	0.151	0.140	A8DZ19.pdb.gz	A8DZ19_DROME Rho-type guanine nucleotide exchange factor, isoform F OS=Drosophila melanogaster OX=7227 GN=RtGEF PE=1 SV=2
7	PDB:4gouA	0.138	0.317	2.173E-9	507	0.032	0.077	4gouA.pdb.gz
8	AFDB:P25558	0.151	0.117	1.927E-8	1636	0.138	0.103	P25558.pdb.gz	BUD3_YEAST Bud site selection protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUD3 PE=1 SV=2
9	AFDB:P49797	0.088	0.110	1.047E-4	967	0.079	0.099	P49797.pdb.gz	RGS3_RAT Regulator of G-protein signaling 3 OS=Rattus norvegicus OX=10116 GN=Rgs3 PE=1 SV=2
10	PDB:3ljuX	0.074	0.218	1.299E-4	373	0.025	0.080	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
11	AFDB:Q38AE6	0.067	0.067	3.659E-4	1203	0.119	0.121	Q38AE6.pdb.gz	Q38AE6_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.2340 PE=4 SV=1
12	AFDB:Q9Z0Y7	0.082	0.082	6.163E-4	1216	0.113	0.113	Q9Z0Y7.pdb.gz	IRS4_MOUSE Insulin receptor substrate 4 OS=Mus musculus OX=10090 GN=Irs4 PE=1 SV=2
13	PDB:6u3eA	0.076	0.204	6.537E-4	397	0.052	0.159	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
14	AFDB:A0A286YBL8	0.081	0.082	9.351E-4	1204	0.112	0.113	A0A286YBL8.pdb.gz	A0A286YBL8_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=ptpn21 PE=3 SV=1
15	AFDB:Q07436	0.075	0.066	9.351E-4	1427	0.143	0.122	Q07436.pdb.gz	EXPA_DROME Protein expanded OS=Drosophila melanogaster OX=7227 GN=ex PE=1 SV=3
16	PDB:5yqrA	0.086	0.325	1.101E-3	268	0.026	0.119	5yqrA.pdb.gz
17	PDB:4mk0A	0.074	0.136	3.122E-3	631	0.023	0.044	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
18	PDB:4uudC	0.069	0.627	6.149E-3	113	0.014	0.150	4uudC.pdb.gz
19	PDB:5yfpH	0.114	0.233	1.571E-2	518	0.032	0.075	5yfpH.pdb.gz
20	PDB:4rm8A	0.078	0.222	1.935E-2	368	0.016	0.052	4rm8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1L390	0.0	2486	1219	1.000	1.000	PKHG3_HUMAN Pleckstrin homology domain-containing family G member 3 OS=Homo sapiens OX=9606 GN=PLEKHG3 PE=1 SV=1
2	Q5JYA6	5.68e-151	491	1385	0.202	0.178	Q5JYA6_HUMAN PLEKHG1 OS=Homo sapiens OX=9606 GN=PLEKHG1 PE=2 SV=1
3	Q9ULL1	5.68e-151	491	1385	0.202	0.178	PKHG1_HUMAN Pleckstrin homology domain-containing family G member 1 OS=Homo sapiens OX=9606 GN=PLEKHG1 PE=1 SV=2
4	Q9H7P9	3.45e-98	345	1386	0.164	0.144	PKHG2_HUMAN Pleckstrin homology domain-containing family G member 2 OS=Homo sapiens OX=9606 GN=PLEKHG2 PE=1 SV=3
5	D4YWB8	4.35e-62	229	775	0.107	0.169	D4YWB8_CAEEL PH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uig-1 PE=1 SV=1
6	Q9XXM9	1.20e-61	230	919	0.107	0.143	Q9XXM9_CAEEL PH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uig-1 PE=1 SV=1
7	G5EER5	2.12e-61	230	952	0.107	0.138	G5EER5_CAEEL PH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uig-1 PE=1 SV=1
8	G5EF62	2.60e-61	230	972	0.107	0.135	G5EF62_CAEEL Protein vav OS=Caenorhabditis elegans OX=6239 GN=uig-1 PE=1 SV=1
9	B6GUP8	2.83e-61	230	958	0.107	0.137	B6GUP8_CAEEL PH domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uig-1 PE=1 SV=1
10	A1ZBA1	1.82e-59	227	1549	0.109	0.086	A1ZBA1_DROME FI17866p1 OS=Drosophila melanogaster OX=7227 GN=GEFmeso PE=2 SV=2
11	A0A0B4KFB7	2.82e-59	223	878	0.105	0.146	A0A0B4KFB7_DROME Guanine nucleotide exchange factor in mesoderm, isoform F OS=Drosophila melanogaster OX=7227 GN=GEFmeso PE=4 SV=1
12	Q8MSP7	6.00e-59	224	1240	0.109	0.107	Q8MSP7_DROME AT03020p OS=Drosophila melanogaster OX=7227 GN=GEFmeso PE=2 SV=1
13	B3DN64	7.15e-59	224	1237	0.109	0.108	B3DN64_DROME Guanine nucleotide exchange factor in mesoderm, isoform G OS=Drosophila melanogaster OX=7227 GN=GEFmeso PE=2 SV=1
14	A0A024RDM6	1.67e-38	156	652	0.081	0.152	A0A024RDM6_HUMAN SPATA13 (Fragment) OS=Homo sapiens OX=9606 GN=SPATA13 PE=4 SV=1
15	Q96N96	1.67e-38	156	652	0.081	0.152	SPT13_HUMAN Spermatogenesis-associated protein 13 OS=Homo sapiens OX=9606 GN=SPATA13 PE=1 SV=1
16	Q9QX73	8.02e-38	151	493	0.089	0.219	ARHG9_RAT Rho guanine nucleotide exchange factor 9 OS=Rattus norvegicus OX=10116 GN=Arhgef9 PE=1 SV=1
17	A0A1B0GV84	1.09e-37	151	506	0.089	0.213	A0A1B0GV84_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
18	A0A1B0GWI5	1.27e-37	151	529	0.089	0.204	A0A1B0GWI5_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
19	A0A1B0GVC4	1.39e-37	149	454	0.089	0.238	A0A1B0GVC4_HUMAN Cdc42 guanine nucleotide exchange factor 9 OS=Homo sapiens OX=9606 GN=ARHGEF9 PE=1 SV=1
20	Q3UTH8	1.85e-37	150	516	0.089	0.209	ARHG9_MOUSE Rho guanine nucleotide exchange factor 9 OS=Mus musculus OX=10090 GN=Arhgef9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00169 PH	0.00027	32.7	PH domain
2	PF15411 PH_10	24	16.6	Pleckstrin homology domain
3	PF16652 PH_13	4.5e+02	12.1	Pleckstrin homology domain
4	PF17838 PH_16	50	15.2	PH domain
5	PF00621 RhoGEF	4e-41	152.8	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000009165

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000025053	0.799	Cell division cycle 42
2	9593.ENSGGOP00000006036	0.651	Neurensin 2
3	9593.ENSGGOP00000026249	0.651	HMG box domain containing 3
4	9593.ENSGGOP00000001834	0.647	Solute carrier family 30 (zinc transporter), member 9
5	9593.ENSGGOP00000007740	0.636	Ras homolog family member U
6	9593.ENSGGOP00000004639	0.595	Uncharacterized protein
7	9593.ENSGGOP00000010349	0.595	Ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2)
8	9593.ENSGGOP00000011318	0.595	Ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3)
9	9593.ENSGGOP00000017243	0.595	Uncharacterized protein
10	9593.ENSGGOP00000001581	0.571	Uncharacterized protein
11	9593.ENSGGOP00000013039	0.566	Gamma-aminobutyric acid (GABA) A receptor, rho 2
12	9593.ENSGGOP00000009237	0.564	Protein phosphatase 1, regulatory subunit 36
13	9593.ENSGGOP00000002701	0.561	Ras homolog family member C
14	9593.ENSGGOP00000012527	0.561	Ras homolog family member A
15	9593.ENSGGOP00000002620	0.554	Uncharacterized protein
16	9593.ENSGGOP00000013414	0.547	Nitric oxide synthase 1 adaptor protein
17	9593.ENSGGOP00000026185	0.546	Ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
18	9593.ENSGGOP00000028746	0.546	Rho guanine nucleotide exchange factor (GEF) 16
19	9593.ENSGGOP00000009462	0.526	Tensin 4
20	9593.ENSGGOP00000015738	0.525	ADAM metallopeptidase with thrombospondin type 1 motif, 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	1.000	actin binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0051056	0.936	regulation of small GTPase mediated signal transduction
GO:0040012	0.901	regulation of locomotion
GO:2000145	0.885	regulation of cell motility
GO:0032878	0.836	regulation of establishment or maintenance of cell polarity
GO:0030334	0.806	regulation of cell migration
GO:0009987	0.630	cellular process
GO:2000114	0.569	regulation of establishment of cell polarity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043229	0.925	intracellular organelle
GO:0043227	0.893	membrane-bounded organelle
GO:0043231	0.798	intracellular membrane-bounded organelle
GO:0005634	0.693	nucleus
GO:0071944	0.505	cell periphery
GO:0005886	0.458	plasma membrane
GO:0070013	0.435	intracellular organelle lumen
GO:0031981	0.429	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]