StarFunc result for job id A1L3X0

User Input

>input (281 residues)
MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTSLGPKLMENRK
PFELKKAMITYNFFIVLFSVYMCYEFVMSGWGIGYSFRCDIVDYSRSPTALRMARTCWLY
YFSKFIELLDTIFFVLRKKNSQVTFLHVFHHTIMPWTWWFGVKFAAGGLGTFHALLNTAV
HVVMYSYYGLSALGPAYQKYLWWKKYLTSLQLVQFVIVAIHISQFFFMEDCKYQFPVFAC
IIMSYSFMFLLLFLHFWYRAYTKGQRLPKTVKNGTCKNKDN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1L3X0	1.000	1.000	6.707E-40	281	1.000	1.000	A1L3X0.pdb.gz	ELOV7_HUMAN Elongation of very long chain fatty acids protein 7 OS=Homo sapiens OX=9606 GN=ELOVL7 PE=1 SV=1
2	PDB:6y7fB	0.894	0.980	2.006E-33	256	0.911	1.000	6y7fB.pdb.gz	Crystal structure of human ELOVL fatty acid elongase 7 (ELOVL7)
3	AFDB:Q9BW60	0.920	0.926	1.537E-26	279	0.566	0.570	Q9BW60.pdb.gz	ELOV1_HUMAN Elongation of very long chain fatty acids protein 1 OS=Homo sapiens OX=9606 GN=ELOVL1 PE=1 SV=1
4	AFDB:A0A0R4IT00	0.914	0.804	2.120E-26	320	0.552	0.484	A0A0R4IT00.pdb.gz	A0A0R4IT00_DANRE Elongation of very long chain fatty acids protein 1 OS=Danio rerio OX=7955 GN=wu:fj32h05 PE=3 SV=1
5	AFDB:Q5XJ87	0.922	0.824	2.324E-26	315	0.559	0.498	Q5XJ87.pdb.gz	Q5XJ87_DANRE Elongation of very long chain fatty acids protein 1 OS=Danio rerio OX=7955 GN=zgc:103538 PE=1 SV=1
6	AFDB:Q9VHX7	0.880	0.756	8.758E-24	329	0.498	0.426	Q9VHX7.pdb.gz	ELOV7_DROME Elongation of very long chain fatty acids protein 7 OS=Drosophila melanogaster OX=7227 GN=Elovl7 PE=2 SV=2
7	AFDB:Q9VCY6	0.878	0.838	9.108E-22	295	0.456	0.434	Q9VCY6.pdb.gz	Q9VCY6_DROME Elongation of very long chain fatty acids protein OS=Drosophila melanogaster OX=7227 GN=sit PE=2 SV=1
8	AFDB:Q9GZR5	0.865	0.778	1.809E-20	314	0.438	0.392	Q9GZR5.pdb.gz	ELOV4_HUMAN Elongation of very long chain fatty acids protein 4 OS=Homo sapiens OX=9606 GN=ELOVL4 PE=1 SV=1
9	AFDB:Q6PBM2	0.894	0.815	2.077E-20	309	0.416	0.379	Q6PBM2.pdb.gz	Q6PBM2_DANRE Elongation of very long chain fatty acids protein 4 OS=Danio rerio OX=7955 GN=zgc:73341 PE=2 SV=1
10	AFDB:Q6P978	0.891	0.829	7.526E-20	303	0.413	0.383	Q6P978.pdb.gz	Q6P978_DANRE Elongation of very long chain fatty acids protein 4 OS=Danio rerio OX=7955 GN=elovl4 PE=2 SV=1
11	AFDB:D9IVG8	0.872	0.803	9.916E-20	306	0.406	0.373	D9IVG8.pdb.gz	D9IVG8_SALSA Elongation of very long chain fatty acids protein 4 OS=Salmo salar OX=8030 GN=elovl4 PE=2 SV=1
12	PDB:7cxrA	0.430	0.401	5.941E-1	307	0.107	0.098	7cxrA.pdb.gz
13	PDB:7vktA	0.164	0.161	8.582E-1	287	0.132	0.129	7vktA.pdb.gz	Structural basis of leukotriene B4 receptor 1 activation.
14	PDB:3axjB	0.165	0.183	8.986E-1	240	0.096	0.113	3axjB.pdb.gz
15	PDB:7f73A	0.450	0.434	1.080	293	0.107	0.102	7f73A.pdb.gz
16	PDB:6wv7B	0.202	0.160	1.131	388	0.064	0.046	6wv7B.pdb.gz	Structural basis of antagonizing the vitamin K catalytic cycle for anticoagulation.
17	PDB:7cgeA	0.141	0.148	1.184	257	0.128	0.140	7cgeA.pdb.gz	Structural mechanism of phospholipids translocation by MlaFEDB complex.
18	PDB:7f3tA	0.436	0.382	1.240	330	0.135	0.115	7f3tA.pdb.gz	TMEM120A contains a specific coenzyme A-binding site and might not mediate poking- or stretch-induced channel activities in cells.
19	PDB:5j4nA	0.205	0.151	1.298	437	0.125	0.080	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
20	PDB:7ezmD	0.177	0.167	1.298	304	0.103	0.095	7ezmD.pdb.gz	Ligand recognition and G-protein coupling selectivity of cholecystokinin A receptor

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1L3X0	0.0	583	281	1.000	1.000	ELOV7_HUMAN Elongation of very long chain fatty acids protein 7 OS=Homo sapiens OX=9606 GN=ELOVL7 PE=1 SV=1
2	Q9BW60	1.90e-121	350	279	0.566	0.570	ELOV1_HUMAN Elongation of very long chain fatty acids protein 1 OS=Homo sapiens OX=9606 GN=ELOVL1 PE=1 SV=1
3	Q9JLJ5	5.21e-120	346	279	0.559	0.563	ELOV1_MOUSE Elongation of very long chain fatty acids protein 1 OS=Mus musculus OX=10090 GN=Elovl1 PE=1 SV=1
4	A0A0R4IT00	7.31e-118	342	320	0.548	0.481	A0A0R4IT00_DANRE Elongation of very long chain fatty acids protein 1 OS=Danio rerio OX=7955 GN=wu:fj32h05 PE=3 SV=1
5	Q5XJ87	7.30e-116	337	315	0.548	0.489	Q5XJ87_DANRE Elongation of very long chain fatty acids protein 1 OS=Danio rerio OX=7955 GN=zgc:103538 PE=1 SV=1
6	Q9VHX7	5.66e-84	256	329	0.498	0.426	ELOV7_DROME Elongation of very long chain fatty acids protein 7 OS=Drosophila melanogaster OX=7227 GN=Elovl7 PE=2 SV=2
7	Q9VCY6	5.99e-77	238	295	0.441	0.420	Q9VCY6_DROME Elongation of very long chain fatty acids protein OS=Drosophila melanogaster OX=7227 GN=sit PE=2 SV=1
8	Q9EQC4	6.03e-74	230	312	0.452	0.407	ELOV4_MOUSE Elongation of very long chain fatty acids protein 4 OS=Mus musculus OX=10090 GN=Elovl4 PE=1 SV=2
9	Q6PBM2	1.68e-73	229	309	0.420	0.382	Q6PBM2_DANRE Elongation of very long chain fatty acids protein 4 OS=Danio rerio OX=7955 GN=zgc:73341 PE=2 SV=1
10	Q6P978	3.76e-73	228	303	0.431	0.399	Q6P978_DANRE Elongation of very long chain fatty acids protein 4 OS=Danio rerio OX=7955 GN=elovl4 PE=2 SV=1
11	Q9GZR5	5.19e-73	228	314	0.431	0.385	ELOV4_HUMAN Elongation of very long chain fatty acids protein 4 OS=Homo sapiens OX=9606 GN=ELOVL4 PE=1 SV=1
12	D9IVG8	8.82e-71	222	306	0.409	0.376	D9IVG8_SALSA Elongation of very long chain fatty acids protein 4 OS=Salmo salar OX=8030 GN=elovl4 PE=2 SV=1
13	E1BYE9	8.19e-61	196	297	0.416	0.394	E1BYE9_CHICK Elongation of very long chain fatty acids protein 2 OS=Gallus gallus OX=9031 GN=ELOVL2 PE=1 SV=1
14	A0A068CAR2	1.44e-60	196	297	0.413	0.391	A0A068CAR2_MELGA Elongation of very long chain fatty acids protein 2 OS=Meleagris gallopavo OX=9103 GN=Elovl2 PE=2 SV=1
15	G1MWP1	2.15e-60	196	313	0.413	0.371	G1MWP1_MELGA Elongation of very long chain fatty acids protein 2 OS=Meleagris gallopavo OX=9103 GN=ELOVL2 PE=3 SV=3
16	Q9VCY7	1.55e-59	194	322	0.381	0.332	Q9VCY7_DROME Elongation of very long chain fatty acids protein OS=Drosophila melanogaster OX=7227 GN=bond PE=2 SV=1
17	Q9JLJ4	2.02e-59	192	292	0.413	0.397	ELOV2_MOUSE Elongation of very long chain fatty acids protein 2 OS=Mus musculus OX=10090 GN=Elovl2 PE=1 SV=1
18	A0A097I5U8	7.02e-59	191	287	0.395	0.387	A0A097I5U8_ONCMY Elongation of very long chain fatty acids protein 2 OS=Oncorhynchus mykiss OX=8022 GN=Elovl2 PE=2 SV=1
19	B6V6V1	8.72e-59	191	287	0.406	0.397	B6V6V1_SALSA Elongation of very long chain fatty acids protein 2 OS=Salmo salar OX=8030 GN=LOC100192341 PE=2 SV=1
20	A0A068C9W5	1.51e-58	190	296	0.406	0.385	A0A068C9W5_ANAPL Elongation of very long chain fatty acids protein 2 OS=Anas platyrhynchos OX=8839 GN=Elovl2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01151 ELO	2.7e-55	199.1	GNS1/SUR4 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000424123

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000278353	0.946	Very-long-chain 3-oxoacyl-CoA reductase
2	9606.ENSP00000359022	0.851	Elongation of very long chain fatty acids protein 3
3	9606.ENSP00000477602	0.806	Elongation of very long chain fatty acids protein 1
4	9606.ENSP00000278840	0.727	Fatty acid desaturase 2
5	9606.ENSP00000253792	0.689	ATP-citrate synthase
6	9606.ENSP00000322229	0.685	Fatty acid desaturase 1
7	9606.ENSP00000310688	0.673	ATP-binding cassette sub-family D member 2
8	9606.ENSP00000263035	0.632	Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial
9	9606.ENSP00000264990	0.629	Acyl-CoA dehydrogenase family member 11
10	9606.ENSP00000359380	0.603	Acyl-CoA desaturase
11	9606.ENSP00000464814	0.595	Bifunctional coenzyme A synthase
12	9606.ENSP00000271688	0.550	Ceramide synthase 2
13	9606.ENSP00000218104	0.541	ATP-binding cassette sub-family D member 1
14	9606.ENSP00000367125	0.521	Probable G-protein coupled receptor 153
15	9606.ENSP00000367319	0.517	F-box only protein 47
16	9606.ENSP00000215567	0.514	Very-long-chain enoyl-CoA reductase
17	9606.ENSP00000278836	0.513	Myelin regulatory factor
18	9606.ENSP00000304592	0.511	Fatty acid synthase
19	9606.ENSP00000316329	0.510	Stearoyl-CoA desaturase 5
20	9606.ENSP00000360316	0.507	Delta(24)-sterol reductase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0009922	1.000	fatty acid elongase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.986	organic substance metabolic process
GO:0044238	0.986	primary metabolic process
GO:0044237	0.986	cellular metabolic process
GO:0044281	0.983	small molecule metabolic process
GO:0008610	0.981	lipid biosynthetic process
GO:0044249	0.978	cellular biosynthetic process
GO:0044255	0.978	cellular lipid metabolic process
GO:0034641	0.972	cellular nitrogen compound metabolic process
GO:0006631	0.961	fatty acid metabolic process
GO:0030497	0.949	fatty acid elongation
GO:0043603	0.945	amide metabolic process
GO:0043604	0.944	amide biosynthetic process
GO:1901564	0.935	organonitrogen compound metabolic process
GO:0042761	0.934	very long-chain fatty acid biosynthetic process
GO:0033875	0.888	ribonucleoside bisphosphate metabolic process
GO:0034032	0.888	purine nucleoside bisphosphate metabolic process
GO:0006637	0.882	acyl-CoA metabolic process
GO:0034030	0.861	ribonucleoside bisphosphate biosynthetic process
GO:0034033	0.861	purine nucleoside bisphosphate biosynthetic process
GO:0035337	0.859	fatty-acyl-CoA metabolic process
GO:0009152	0.858	purine ribonucleotide biosynthetic process
GO:1901570	0.849	fatty acid derivative biosynthetic process
GO:0071616	0.815	acyl-CoA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:14993	1.000	acetyl-CoA + 2n H(+) + n malonyl-CoA + 2n NADPH = a long-chain fatty acid + n CO2 + (n+1) CoA + 2n NADP(+)
EC:2.3.1.85	1.000	fatty-acid synthase system.

[back to server]