StarFunc result for job id A1L443

User Input

>input (756 residues)
MASNGAYPVLGPGVTVNPGTSLSVFTALPFATPAPGPAHRPPLVTAVVPPAGPLVLSAFP
STPLVAGQDGRGPSGAGASNVFVQMRTEVGPVKPPQAQTLILTQAPLVWQAPGTLCGGVM
CPPPLLLAAAPGVPVTSAQVVGGTQACEGGWSHGLPLPPPPPAAQVAPIVSPGNARPWPQ
GAHGEGSLAPSQAKARPDDSCKPKSVYENFRLWQHYKPLARRHLPQSPDTEALSCFLIPV
LRSLARRKPTMTLEEGLWQAMREWQHTSNFDRMIFYEMAEKFLEFEAEEEMQIQKSQWMK
GPQSLPPPAPPRLEPRGPPAPEVVKQPVYLPSKDGPKAPTACLPPPRPQRPAETKAHLPP
PRPQRPAETNAHLPPPRPQRPAETKVPEEIPPEVVQEYVDIMEELLGSHPGDTGEPEGQR
EKGKVEQPQEEDGITSDPGLLSYIDKLCSQEDFVTKVEAVIHPRFLEELLSPDPQMDFLA
LSQELEQEEGLTLAQLVEKRLLSLKEKGCGRAAPRHGTARLDSSPSEFAAGQEAAREVPD
PQQRVSVETSPPQTAAQDPQGQGRVRTGMARSEDPAVLLGCQDSPRLKAVRPTSPPQDHR
PTCPGLGTKDALGLPGESPVKESHGLAKGSSEETELPGMVYVVGSHHRLRPWRLSQSPVP
SSGLLSPGGRGPQGALQSPSAQKRGLSPSPSPASKSKKRPLFGSPSPAEKTPHPGPGLRV
SGEQSLAWGLGGPSQSQKRKGDPLASRRKKKRHCSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86Y26	0.142	0.097	1.979E-35	1132	0.417	0.278	Q86Y26.pdb.gz	NUTM1_HUMAN NUT family member 1 OS=Homo sapiens OX=9606 GN=NUTM1 PE=1 SV=2
2	AFDB:Q9H4M7	0.057	0.056	5.492E-3	779	0.159	0.154	Q9H4M7.pdb.gz	PKHA4_HUMAN Pleckstrin homology domain-containing family A member 4 OS=Homo sapiens OX=9606 GN=PLEKHA4 PE=1 SV=2
3	AFDB:A0A0R4IR86	0.058	0.029	9.230E-3	1799	0.124	0.052	A0A0R4IR86.pdb.gz	A0A0R4IR86_DANRE DNA helicase OS=Danio rerio OX=7955 GN=si:ch211-196l7.5 PE=1 SV=1
4	AFDB:P40656	0.089	0.100	1.551E-2	669	0.165	0.187	P40656.pdb.gz	SOX14_DROME Putative transcription factor SOX-14 OS=Drosophila melanogaster OX=7227 GN=Sox14 PE=2 SV=3
5	AFDB:P98081	0.057	0.032	1.551E-2	2224	0.188	0.064	P98081.pdb.gz	DAB_DROME Protein disabled OS=Drosophila melanogaster OX=7227 GN=Dab PE=1 SV=2
6	AFDB:A0A0S2Z4M1	0.072	0.070	1.844E-2	779	0.130	0.126	A0A0S2Z4M1.pdb.gz	A0A0S2Z4M1_HUMAN Axin 1 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=AXIN1 PE=1 SV=1
7	AFDB:Q9LM88	0.082	0.092	1.954E-2	652	0.120	0.140	Q9LM88.pdb.gz	Q9LM88_ARATH At1g20670 OS=Arabidopsis thaliana OX=3702 GN=At1g20670 PE=1 SV=1
8	AFDB:F4K704	0.064	0.066	5.518E-2	833	0.144	0.131	F4K704.pdb.gz	F4K704_ARATH LA RNA-binding protein OS=Arabidopsis thaliana OX=3702 GN=LARP1A PE=1 SV=1
9	AFDB:Q8I239	0.053	0.032	6.193E-2	1710	0.086	0.038	Q8I239.pdb.gz	PI51N_PLAF7 Phosphatidylinositol 4-phosphate 5-kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PIP5K PE=1 SV=1
10	AFDB:P57094	0.064	0.059	8.264E-2	835	0.136	0.123	P57094.pdb.gz	AXIN1_DANRE Axin-1 OS=Danio rerio OX=7955 GN=axin1 PE=1 SV=2
11	PDB:2lrmA	0.057	0.321	1.138	84	0.013	0.119	2lrmA.pdb.gz
12	PDB:7qsmW	0.047	0.197	1.705	116	0.024	0.155	7qsmW.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
13	PDB:1j5nA	0.075	0.528	2.275	93	0.012	0.097	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
14	PDB:7zs9M	0.064	0.128	2.275	310	0.016	0.039	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
15	PDB:7acoB	0.043	0.127	2.553	180	0.017	0.072	7acoB.pdb.gz
16	PDB:7ajtUO	0.053	0.073	2.865	493	0.021	0.032	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
17	PDB:7ml4M	0.057	0.120	3.035	234	0.019	0.060	7ml4M.pdb.gz	Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.
18	PDB:2y6xA	0.067	0.249	3.609	109	0.016	0.110	2y6xA.pdb.gz
19	PDB:2cwoA	0.050	0.173	3.823	165	0.017	0.079	2cwoA.pdb.gz
20	PDB:2w4mA	0.067	0.170	3.823	250	0.012	0.036	2w4mA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7ZLH0	0.0	1483	755	0.996	0.997	B7ZLH0_HUMAN FAM22F protein OS=Homo sapiens OX=9606 GN=FAM22F PE=1 SV=1
2	Q86Y26	7.64e-127	407	1132	0.366	0.245	NUTM1_HUMAN NUT family member 1 OS=Homo sapiens OX=9606 GN=NUTM1 PE=1 SV=2
3	Q8RZ35	0.93	35.0	388	0.042	0.082	ABI5_ORYSJ bZIP transcription factor ABI5 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=ABI5 PE=1 SV=1
4	Q96T58	3.1	33.9	3664	0.033	0.007	MINT_HUMAN Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12881 NUT	0	1121.8	NUT protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253262

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000353863	0.683	Zinc finger protein 148
2	9606.ENSP00000318716	0.556	Protein FAM9B
3	9606.ENSP00000429808	0.519	Protocadherin alpha-3
4	9606.ENSP00000253247	0.504	Nucleolar protein 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.408	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.984	regulation of cellular process
GO:0009987	0.981	cellular process
GO:0051171	0.947	regulation of nitrogen compound metabolic process
GO:0080090	0.938	regulation of primary metabolic process
GO:0060255	0.936	regulation of macromolecule metabolic process
GO:0019219	0.916	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.903	regulation of DNA-templated transcription
GO:0050896	0.820	response to stimulus
GO:0048518	0.757	positive regulation of biological process
GO:0048522	0.699	positive regulation of cellular process
GO:0071704	0.601	organic substance metabolic process
GO:0010604	0.556	positive regulation of macromolecule metabolic process
GO:0031325	0.556	positive regulation of cellular metabolic process
GO:0051173	0.533	positive regulation of nitrogen compound metabolic process
GO:0044237	0.456	cellular metabolic process
GO:0032502	0.406	developmental process
GO:0045935	0.396	positive regulation of nucleobase-containing compound metabolic process
GO:0051716	0.308	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.991	cytoplasm
GO:0043232	0.980	intracellular non-membrane-bounded organelle
GO:0005694	0.426	chromosome
GO:0016604	0.384	nuclear body
GO:0005829	0.345	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]