StarFunc result for job id A1L4H1

User Input

>input (1573 residues)
MRVLACLLAALVGIQAVERLRLADGPHGCAGRLEVWHGGRWGTVCDDGWDLRDAAVACRQ
LGCGGALAAPGGAFFGEGAGPVWLSELACRGNEGQLGLCHHRGWKAHICSHEEDAGVVCA
GQRVANSRDDSTSPLDGAPWPGLLLELSPSTEEPLVTHAPRPAGNPQNASRKKSPRPKQA
KSTRAPLLTTGAPRQERLRLVSGPHRCAGRLEVWHGGRWGTVCDDGWDLRDAAVACRELG
CGGALAAPGGARFGPGAGPVWMDDVGCGGGEQALRDCPRSPWGRSNCDHSEDAGLVCTGP
APRLRLADGPHGCAGRLEVWHGGRWGSVCDDAWDLRDAAVACRELGCGGALAAPGGAFFG
EGSGPIILDDLRCRGNETALRFCPARPWGQHDCHHREDAGAVCDGMPLGYVPPTAPTDSN
NSTPREAASRPPSTMTSQAPGTAGVSPPPASPTVLWEPGPEAGSPQLRLVAGPSKCSGRL
EVWHDQRWGTVCDDSWDMRDSAVVCRELGCGGPQQPDPAAGRFGWGAGPIWLDDVGCVGT
EASLSDCPAAPWGKHNCAHNEDVGVTCTGPPGLDSISDPFSWSWIPGLGRDRDAWLPGEL
ATKPSASVTASVLEKTTTKAPGKMPKSTKKWVTKNAKRPTTQPPVMPTTKHSRAQSPPDL
TSQTTAALTTEASRRPTSEFTRRPTTEAPQRWTSHTTATLTPQAPRERTTKTMAMLTTQG
PQEMTSESTIKSIPQASLEPSAEIPEGSPESPKDPAPSPSVSTTGESGLFRVRLADGPNR
CAGRLEVWHAGRWGTVCDDNWDLRDATVACWELGCGKVRPRVGKTHYGPGTGPIWLDDMG
CKGSEASLSDCPSGAWGKHNCDHEEDVGLTCTGYTDYDDYPPWTWDPTSREDLAKGTTTA
GVPGHTLPWRTTRRPGSSSPAIRRLPDTGSKDGYKLPWTWDTPSGRGLAEGTPTAGKLGP
TLGAGTTRSPGSPPTLRVHGDTGSPRKPWPERRPPRPAATRTAPPTPSPGPSASPGPPGP
ALTSDSSRELTPHSALTSEATSDAPDTSPPTPDPASRTNPDLILTSPDFALSTPDSSVVP
ALTPEPSPTPLPTLPKELTSDPSTPSEVTSLSPTSEQVPESDTTPDLDTTPYSSTVSEYS
RSPDPSPSPHPTTTPDPTMAPDPITTLNPTVTPHFPTTPHPTTTPHPTTITHSTMIPDPT
TTPQPFTTITHSTMIPDPTTTPQPFTTMQPTTTPHSTTPHPTTTPHPTTITHSTMIPDPT
TTPQPFTTMQPTTMPHPTTTPHPTTTPHPTTTPHPTTTPHPTMTPDPTTTPYPTTTPDPT
TTPHPTTPDPSSTPVITTVSLPTSLGTELSSPTLAPTVKPSLHPQLTFTAPAPHTSTSQI
PTLEPSPALESSPSRSSTATSMDPLSTEDFKPPRSQSPNLTPPPTHTPHSASDLTVSPDP
LLSPTAHPLDHPPLDPLTLGPTPGQSPGPHGPCVAPTPPVRVMACEPPALVELVAAVRDV
GGQLQRLTQVVEQERQERQALLLGLTQLVEAARGLGQLGEAVKRLAEMAWTTSMPAPTTT
TPEEEERPLRGDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1L4H1	0.999	0.999	0.000	1573	1.000	1.000	A1L4H1.pdb.gz	SRCRL_HUMAN Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Homo sapiens OX=9606 GN=SSC5D PE=1 SV=3
2	AFDB:Q8BV57	0.336	0.376	0.000	1371	0.652	0.748	Q8BV57.pdb.gz	SRCRL_MOUSE Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Mus musculus OX=10090 GN=Ssc5d PE=1 SV=1
3	PDB:2xrcC	0.059	0.188	2.640E-5	454	0.017	0.059	2xrcC.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
4	PDB:2xrcB	0.064	0.199	5.693E-4	485	0.018	0.058	2xrcB.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
5	AFDB:F1Q897	0.043	0.044	8.441E-4	1503	0.098	0.102	F1Q897.pdb.gz	F1Q897_DANRE Membrane-associated guanylate kinase, WW and PDZ domain-containing 2a OS=Danio rerio OX=7955 GN=fb82g11 PE=4 SV=3
6	AFDB:P19538	0.035	0.031	8.917E-4	1397	0.118	0.133	P19538.pdb.gz	CI_DROME Transcriptional activator cubitus interruptus OS=Drosophila melanogaster OX=7227 GN=ci PE=1 SV=2
7	AFDB:Q99NE5	0.048	0.049	1.819E-3	1463	0.100	0.107	Q99NE5.pdb.gz	RIMS1_MOUSE Regulating synaptic membrane exocytosis protein 1 OS=Mus musculus OX=10090 GN=Rims1 PE=1 SV=2
8	AFDB:P08120	0.032	0.029	2.032E-2	1779	0.142	0.125	P08120.pdb.gz	CO4A1_DROME Collagen alpha-1(IV) chain OS=Drosophila melanogaster OX=7227 GN=Col4a1 PE=1 SV=3
9	AFDB:F1Q6T6	0.036	0.027	2.146E-2	2357	0.152	0.101	F1Q6T6.pdb.gz
10	AFDB:F1Q9U2	0.035	0.029	2.146E-2	2065	0.129	0.098	F1Q9U2.pdb.gz
11	AFDB:Q8NEY1	0.047	0.041	2.267E-2	1877	0.118	0.099	Q8NEY1.pdb.gz	NAV1_HUMAN Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2
12	AFDB:A2CG63	0.046	0.052	2.395E-2	1314	0.079	0.094	A2CG63.pdb.gz	ARI4B_MOUSE AT-rich interactive domain-containing protein 4B OS=Mus musculus OX=10090 GN=Arid4b PE=1 SV=1
13	PDB:2k8pA	0.029	0.098	4.586	189	0.017	0.143	2k8pA.pdb.gz
14	PDB:7a5hU	0.039	0.218	6.733	152	0.009	0.092	7a5hU.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
15	PDB:2mpmA	0.013	0.189	7.112	74	0.003	0.068	2mpmA.pdb.gz	Structural Basis of Receptor Sulfotyrosine Recognition by a CC Chemokine: The N-Terminal Region of CCR3 Bound to CCL11/Eotaxin-1.
16	PDB:1y14B	0.016	0.104	7.937	154	0.004	0.039	1y14B.pdb.gz
17	PDB:3jb9E	0.014	0.127	8.384	98	0.007	0.112	3jb9E.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
18	PDB:4fl2A	0.014	0.036	8.384	555	0.004	0.013	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
19	PDB:6g18v	0.018	0.070	8.857	325	0.005	0.025	6g18v.pdb.gz	Visualizing late states of human 40S ribosomal subunit maturation.
20	PDB:1jqmB	0.027	0.049	9.356	691	0.013	0.030	1jqmB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1L4H1	0.0	3079	1573	1.000	1.000	SRCRL_HUMAN Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Homo sapiens OX=9606 GN=SSC5D PE=1 SV=3
2	Q8BV57	0.0	1521	1371	0.552	0.634	SRCRL_MOUSE Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Mus musculus OX=10090 GN=Ssc5d PE=1 SV=1
3	Q9UGM3	5.01e-156	529	2413	0.207	0.135	DMBT1_HUMAN Deleted in malignant brain tumors 1 protein OS=Homo sapiens OX=9606 GN=DMBT1 PE=1 SV=2
4	Q60997	3.61e-127	442	2085	0.155	0.117	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2
5	Q86VB7	1.14e-103	362	1156	0.147	0.201	C163A_HUMAN Scavenger receptor cysteine-rich type 1 protein M130 OS=Homo sapiens OX=9606 GN=CD163 PE=1 SV=2
6	A0A0G2JVY2	4.21e-97	342	1151	0.138	0.189	A0A0G2JVY2_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=1 SV=2
7	A0A8I5ZQF0	8.43e-97	340	1109	0.138	0.196	A0A8I5ZQF0_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=1 SV=1
8	D3Z9U2	9.78e-97	340	1110	0.138	0.195	D3Z9U2_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=4 SV=2
9	Q8CIZ5	4.77e-96	343	1418	0.116	0.128	DMBT1_RAT Deleted in malignant brain tumors 1 protein OS=Rattus norvegicus OX=10116 GN=Dmbt1 PE=1 SV=1
10	B3F5L4	2.56e-95	336	1112	0.140	0.199	B3F5L4_MOUSE SCART2 splice variant A OS=Mus musculus OX=10090 GN=Scart2 PE=1 SV=1
11	B3F5L5	3.65e-95	333	996	0.140	0.222	B3F5L5_MOUSE SCART2 splice variant B OS=Mus musculus OX=10090 GN=Scart2 PE=1 SV=1
12	Q8CGY7	4.25e-95	333	989	0.140	0.223	Q8CGY7_MOUSE Scavenger receptor cysteine-rich type 1 protein CD163c-alpha OS=Mus musculus OX=10090 GN=Scart1 PE=1 SV=1
13	A0A1B0GSB0	2.23e-94	331	991	0.140	0.222	A0A1B0GSB0_MOUSE Scavenger receptor family member expressed on T cells 1 OS=Mus musculus OX=10090 GN=Scart1 PE=1 SV=1
14	Q8BIC8	1.15e-92	326	991	0.139	0.221	Q8BIC8_MOUSE SRCR domain-containing protein OS=Mus musculus OX=10090 GN=Scart1 PE=2 SV=1
15	P56730	1.49e-74	270	875	0.097	0.175	NETR_HUMAN Neurotrypsin OS=Homo sapiens OX=9606 GN=PRSS12 PE=2 SV=2
16	O08762	4.72e-74	266	761	0.095	0.196	NETR_MOUSE Neurotrypsin OS=Mus musculus OX=10090 GN=Prss12 PE=1 SV=1
17	O43866	1.00e-69	240	347	0.092	0.415	CD5L_HUMAN CD5 antigen-like OS=Homo sapiens OX=9606 GN=CD5L PE=1 SV=1
18	Q4G0T1	5.71e-65	243	1027	0.130	0.200	SRCRM_HUMAN Scavenger receptor cysteine-rich domain-containing protein SCART1 OS=Homo sapiens OX=9606 GN=SCART1 PE=1 SV=2
19	B8A4W9	9.87e-53	202	807	0.102	0.200	LOX3B_DANRE Lysyl oxidase homolog 3B OS=Danio rerio OX=7955 GN=loxl3b PE=2 SV=1
20	Q9QWK4	1.32e-50	185	352	0.062	0.276	CD5L_MOUSE CD5 antigen-like OS=Mus musculus OX=10090 GN=Cd5l PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09272 Hepsin-SRCR	2e+02	14.1	Hepsin, SRCR domain
2	PF00530 SRCR	3.4e-145	484.7	Scavenger receptor cysteine-rich domain
3	PF15494 SRCR_2	1.7e-10	52.8	Scavenger receptor cysteine-rich domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000374274

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000479762	0.571	Ras-related protein Rab-7b
2	9606.ENSP00000409382	0.541	EF-hand calcium-binding domain-containing protein 4B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.960	response to stimulus
GO:0050789	0.955	regulation of biological process
GO:0009987	0.855	cellular process
GO:0006950	0.809	response to stress
GO:0050794	0.774	regulation of cellular process
GO:0009607	0.720	response to biotic stimulus
GO:0009605	0.646	response to external stimulus
GO:0044419	0.623	biological process involved in interspecies interaction between organisms
GO:0019222	0.561	regulation of metabolic process
GO:0051707	0.544	response to other organism
GO:0060255	0.539	regulation of macromolecule metabolic process
GO:0010468	0.486	regulation of gene expression
GO:0006952	0.478	defense response
GO:0051239	0.474	regulation of multicellular organismal process
GO:0009617	0.429	response to bacterium
GO:0048518	0.406	positive regulation of biological process
GO:0009595	0.395	detection of biotic stimulus
GO:0048522	0.352	positive regulation of cellular process
GO:0042221	0.341	response to chemical
GO:0048519	0.334	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.996	extracellular region
GO:0071944	0.972	cell periphery
GO:0012505	0.959	endomembrane system
GO:0043226	0.956	organelle
GO:0005737	0.956	cytoplasm
GO:0043227	0.954	membrane-bounded organelle
GO:0005615	0.949	extracellular space
GO:0043229	0.937	intracellular organelle
GO:0031012	0.881	extracellular matrix
GO:0031982	0.872	vesicle
GO:0031410	0.794	cytoplasmic vesicle
GO:0062023	0.615	collagen-containing extracellular matrix
GO:0016020	0.595	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]