StarFunc result for job id A1YPR0

User Input

>input (619 residues)
MANDIDELIGIPFPNHSSEVLCSLNEQRHDGLLCDVLLVVQEQEYRTHRSVLAACSKYFK
KLFTAGTLASQPYVYEIDFVQPEALAAILEFAYTSTLTITAGNVKHILNAARMLEIQCIV
NVCLEIMEPGGDGGEEDDKEDDDDDEDDDDEEDEEEEEEEEEDDDDDTEDFADQENLPDP
QDISCHQSPSKTDHLTEKAYSDTPRDFPDSFQAGSPGHLGVIRDFSIESLLRENLYPKAN
IPDRRPSLSPFAPDFFPHLWPGDFGAFAQLPEQPMDSGPLDLVIKNRKIKEEEKEELPPP
PPPPFPNDFFKDMFPDLPGGPLGPIKAENDYGAYLNFLSATHLGGLFPPWPLVEERKLKP
KASQQCPICHKVIMGAGKLPRHMRTHTGEKPYMCTICEVRFTRQDKLKIHMRKHTGERPY
LCIHCNAKFVHNYDLKNHMRIHTGVRPYQCEFCYKSFTRSDHLHRHIKRQSCRMARPRRG
RKPAAWRAASLLFGPGGPAPDKAAFVMPPALGEVGGHLGGAAVCLPGPSPAKHFLAAPKG
ALSLQELERQFEETQMKLFGRAQLEAERNAGGLLAFALAENVAAARPYFPLPDPWAAGLA
GLPGLAGLNHVASMSEANN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1YPR0	0.999	0.999	0.000	619	1.000	1.000	A1YPR0.pdb.gz	ZBT7C_HUMAN Zinc finger and BTB domain-containing protein 7C OS=Homo sapiens OX=9606 GN=ZBTB7C PE=2 SV=1
2	AFDB:Q64321	0.196	0.221	9.687E-25	544	0.325	0.369	Q64321.pdb.gz	ZBT7B_MOUSE Zinc finger and BTB domain-containing protein 7B OS=Mus musculus OX=10090 GN=Zbtb7b PE=1 SV=2
3	AFDB:Q8NCP5	0.182	0.197	5.587E-23	570	0.204	0.221	Q8NCP5.pdb.gz	ZBT44_HUMAN Zinc finger and BTB domain-containing protein 44 OS=Homo sapiens OX=9606 GN=ZBTB44 PE=1 SV=1
4	AFDB:Q13105	0.179	0.141	1.467E-21	803	0.246	0.189	Q13105.pdb.gz	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3
5	AFDB:Q8BID6	0.201	0.207	2.846E-20	600	0.200	0.207	Q8BID6.pdb.gz	ZBT46_MOUSE Zinc finger and BTB domain-containing protein 46 OS=Mus musculus OX=10090 GN=Zbtb46 PE=1 SV=2
6	AFDB:Q96K62	0.176	0.212	8.460E-20	511	0.199	0.241	Q96K62.pdb.gz	ZBT45_HUMAN Zinc finger and BTB domain-containing protein 45 OS=Homo sapiens OX=9606 GN=ZBTB45 PE=1 SV=1
7	AFDB:O43298	0.187	0.246	2.515E-19	467	0.186	0.246	O43298.pdb.gz	ZBT43_HUMAN Zinc finger and BTB domain-containing protein 43 OS=Homo sapiens OX=9606 GN=ZBTB43 PE=1 SV=1
8	AFDB:Q86T24	0.180	0.167	1.289E-18	672	0.218	0.201	Q86T24.pdb.gz	KAISO_HUMAN Transcriptional regulator Kaiso OS=Homo sapiens OX=9606 GN=ZBTB33 PE=1 SV=2
9	AFDB:Q8BN78	0.183	0.170	1.545E-18	671	0.200	0.185	Q8BN78.pdb.gz	KAISO_MOUSE Transcriptional regulator Kaiso OS=Mus musculus OX=10090 GN=Zbtb33 PE=1 SV=1
10	AFDB:Q8UVQ4	0.188	0.167	3.605E-18	701	0.204	0.180	Q8UVQ4.pdb.gz	KAISO_XENLA Transcriptional regulator Kaiso OS=Xenopus laevis OX=8355 GN=zbtb33 PE=1 SV=2
11	PDB:6wcqC	0.177	0.798	2.605E-9	130	0.057	0.269	6wcqC.pdb.gz
12	PDB:3w5kB	0.085	0.282	1.897E-4	110	0.061	0.345	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
13	PDB:7mk2A	0.163	0.276	4.703E-4	354	0.039	0.068	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.
14	PDB:2p1nD	0.116	0.521	2.403E-2	127	0.019	0.094	2p1nD.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
15	PDB:3ogkA	0.122	0.487	6.328E-2	145	0.019	0.083	3ogkA.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
16	PDB:5vztA	0.125	0.486	1.881E-1	145	0.023	0.097	5vztA.pdb.gz	Structural basis of the phosphorylation-independent recognition of cyclin D1 by the SCFFBXO31 ubiquitin ligase.
17	PDB:2a79B	0.124	0.271	2.873E-1	259	0.026	0.062	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
18	PDB:6sgaFS	0.123	0.262	3.243E-1	277	0.032	0.072	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
19	PDB:7sizB	0.126	0.220	3.445E-1	334	0.026	0.048	7sizB.pdb.gz	Structural basis for C-type inactivation in a Shaker family voltage-gated K + channel.
20	PDB:7f3fA	0.114	0.149	4.953E-1	460	0.026	0.035	7f3fA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1YPR0	0.0	1277	619	1.000	1.000	ZBT7C_HUMAN Zinc finger and BTB domain-containing protein 7C OS=Homo sapiens OX=9606 GN=ZBTB7C PE=2 SV=1
2	Q8VCZ7	0.0	1111	619	0.942	0.942	ZBT7C_MOUSE Zinc finger and BTB domain-containing protein 7C OS=Mus musculus OX=10090 GN=Zbtb7c PE=2 SV=1
3	Q9QZ48	1.48e-70	240	569	0.168	0.183	ZBT7A_RAT Zinc finger and BTB domain-containing protein 7A OS=Rattus norvegicus OX=10116 GN=Zbtb7a PE=1 SV=1
4	O95365	1.50e-70	240	584	0.168	0.178	ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1
5	O88939	1.88e-70	240	569	0.168	0.183	ZBT7A_MOUSE Zinc finger and BTB domain-containing protein 7A OS=Mus musculus OX=10090 GN=Zbtb7a PE=1 SV=2
6	O15156	1.03e-57	205	539	0.173	0.199	ZBT7B_HUMAN Zinc finger and BTB domain-containing protein 7B OS=Homo sapiens OX=9606 GN=ZBTB7B PE=1 SV=2
7	Q64321	3.55e-56	201	544	0.145	0.165	ZBT7B_MOUSE Zinc finger and BTB domain-containing protein 7B OS=Mus musculus OX=10090 GN=Zbtb7b PE=1 SV=2
8	Q05516	2.24e-30	129	673	0.220	0.202	ZBT16_HUMAN Zinc finger and BTB domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZBTB16 PE=1 SV=2
9	Q3UQ17	2.02e-29	125	673	0.229	0.211	Q3UQ17_MOUSE Zinc finger and BTB domain containing 16 OS=Mus musculus OX=10090 GN=Zbtb16 PE=1 SV=1
10	Q5S3S9	4.34e-29	125	673	0.226	0.208	Q5S3S9_RAT Promyelocytic leukemia zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zbtb16 PE=1 SV=1
11	P13360	5.33e-27	118	604	0.076	0.078	GLAS_DROME Protein glass OS=Drosophila melanogaster OX=7227 GN=gl PE=1 SV=2
12	E9PUT0	3.17e-26	114	460	0.092	0.124	E9PUT0_MOUSE Zinc finger protein 983 OS=Mus musculus OX=10090 GN=Zfp983 PE=1 SV=1
13	A3KMN0	4.41e-26	115	651	0.221	0.210	A3KMN0_MOUSE Zbtb16 protein (Fragment) OS=Mus musculus OX=10090 GN=Zbtb16 PE=2 SV=1
14	P07247	7.15e-26	114	502	0.082	0.102	KRUP_DROME Protein krueppel OS=Drosophila melanogaster OX=7227 GN=Kr PE=1 SV=2
15	Q0PCD8	2.87e-25	107	273	0.078	0.176	Q0PCD8_CAEEL C2H2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=che-1 PE=4 SV=1
16	Q966L8	3.89e-25	107	279	0.078	0.172	CHE1_CAEEL Transcription factor che-1 OS=Caenorhabditis elegans OX=6239 GN=che-1 PE=1 SV=3
17	Q8IGP5	5.13e-25	111	566	0.100	0.110	Q8IGP5_DROME Chromatin-linked adaptor for MSL proteins, isoform B OS=Drosophila melanogaster OX=7227 GN=Clamp PE=1 SV=1
18	P10754	6.13e-25	111	512	0.082	0.100	RHIT_MOUSE Transcriptional repressor Rhit OS=Mus musculus OX=10090 GN=Zfp13 PE=1 SV=2
19	O95201	7.82e-25	111	554	0.082	0.092	RHIT_HUMAN Transcriptional repressor RHIT OS=Homo sapiens OX=9606 GN=ZNF205 PE=1 SV=2
20	Q9BUG6	1.31e-24	110	496	0.078	0.097	ZSA5A_HUMAN Zinc finger and SCAN domain-containing protein 5A OS=Homo sapiens OX=9606 GN=ZSCAN5A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03987 Autophagy_act_C	4.2e+02	12.2	Autophagocytosis associated protein, active-site domain
2	PF00651 BTB	1.5e-27	107.4	BTB/POZ domain
3	PF02724 CDC45	3.6e+02	10.8	CDC45-like protein
4	PF10446 DUF2457	7.1e+02	10.7	Protein of unknown function (DUF2457)
5	PF09237 GAGA	8.2e+02	11.4	GAGA factor
6	PF17875 RPA43_OB	7e+02	12.1	RPA43 OB domain in RNA Pol I
7	PF17110 TFB6	3e+02	12.6	Subunit 11 of the general transcription factor TFIIH
8	PF00096 zf-C2H2	4.5e-10	50.6	Zinc finger, C2H2 type
9	PF13894 zf-C2H2_4	2.4e-09	48.2	C2H2-type zinc finger
10	PF13912 zf-C2H2_6	99	14.4	C2H2-type zinc finger
11	PF13465 zf-H2C2_2	1.8e-16	70.9	Zinc-finger double domain
12	PF12874 zf-met	9e+02	11.7	Zinc-finger of C2H2 type
13	PF14369 zinc_ribbon_9	81	14.9	zinc-ribbon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000468782

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000412763	0.768	MAM and LDL-receptor class A domain-containing protein 1
2	9606.ENSP00000262622	0.700	Carbohydrate sulfotransferase 8
3	9606.ENSP00000221891	0.680	Amyloid-like protein 1
4	9606.ENSP00000339115	0.654	Espin-like protein
5	9606.ENSP00000353732	0.649	CAP-Gly domain-containing linker protein 3
6	9606.ENSP00000268712	0.644	Nuclear receptor corepressor 1
7	9606.ENSP00000313504	0.636	Phosphorylase b kinase regulatory subunit beta
8	9606.ENSP00000353458	0.636	Bromodomain adjacent to zinc finger domain protein 1A
9	9606.ENSP00000261588	0.593	Protein KIAA0556
10	9606.ENSP00000372459	0.562	CBP80/20-dependent translation initiation factor
11	9606.ENSP00000378187	0.515	Adenylate cyclase type 7
12	9606.ENSP00000338010	0.510	Interleukin-21 receptor
13	9606.ENSP00000419325	0.510	Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.922	heterocyclic compound binding
GO:0097159	0.921	organic cyclic compound binding
GO:1990837	0.905	sequence-specific double-stranded DNA binding
GO:0140110	0.818	transcription regulator activity
GO:0003700	0.791	DNA-binding transcription factor activity
GO:0000981	0.744	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.724	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001217	0.586	DNA-binding transcription repressor activity
GO:0001227	0.584	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050794	0.988	regulation of cellular process
GO:0048523	0.963	negative regulation of cellular process
GO:0009987	0.892	cellular process
GO:0019222	0.757	regulation of metabolic process
GO:0051171	0.754	regulation of nitrogen compound metabolic process
GO:0080090	0.751	regulation of primary metabolic process
GO:0031323	0.743	regulation of cellular metabolic process
GO:0060255	0.734	regulation of macromolecule metabolic process
GO:0031326	0.547	regulation of cellular biosynthetic process
GO:0010556	0.546	regulation of macromolecule biosynthetic process
GO:0019219	0.546	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.540	positive regulation of biological process
GO:0010468	0.533	regulation of gene expression
GO:0006355	0.472	regulation of DNA-templated transcription
GO:0032501	0.452	multicellular organismal process
GO:0050896	0.410	response to stimulus
GO:0071704	0.381	organic substance metabolic process
GO:0032502	0.332	developmental process
GO:0044238	0.331	primary metabolic process
GO:0048522	0.322	positive regulation of cellular process
GO:0048856	0.314	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.715	cytoplasm
GO:0031981	0.536	nuclear lumen
GO:0016020	0.333	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]