StarFunc result for job id A1Z1Q3

User Input

>input (425 residues)
MYPSNKKKKVWREEKERLLKMTLEERRKEYLRDYIPLNSILSWKEEMKGKGQNDEENTQE
TSQVKKSLTEKVSLYRGDITLLEVDAIVNAANASLLGGGGVDGCIHRAAGPCLLAECRNL
NGCDTGHAKITCGYDLPAKYVIHTVGPIARGHINGSHKEDLANCYKSSLKLVKENNIRSV
AFPCISTGIYGFPNEPAAVIALNTIKEWLAKNHHEVDRIIFCVFLEVDFKIYKKKMNEFF
SVDDNNEEEEDVEMKEDSDENGPEEKQSVEEMEEQSQDADGVNTVTVPGPASEEAVEDCK
DEDFAKDENITKGGEVTDHSVRDQDHPDGQENDSTKNEIKIETESQSSYMETEELSSNQE
DAVIVEQPEVIPLTEDQEEKEGEKAPGEDTPRMPGKSEGSSDLENTPGPDAGAQDEAKEQ
RNGTK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A1Z1Q3	0.999	0.999	2.853E-69	425	1.000	1.000	A1Z1Q3.pdb.gz	MACD2_HUMAN ADP-ribose glycohydrolase MACROD2 OS=Homo sapiens OX=9606 GN=MACROD2 PE=1 SV=2
2	AFDB:A0A2R8YFN3	0.590	0.554	5.791E-64	453	1.000	0.938	A0A2R8YFN3.pdb.gz	A0A2R8YFN3_HUMAN Mono-ADP ribosylhydrolase 2 OS=Homo sapiens OX=9606 GN=MACROD2 PE=1 SV=1
3	AFDB:Q3UYG8	0.568	0.508	4.061E-55	475	0.788	0.705	Q3UYG8.pdb.gz	MACD2_MOUSE ADP-ribose glycohydrolase MACROD2 OS=Mus musculus OX=10090 GN=Macrod2 PE=1 SV=1
4	PDB:6y4zA	0.508	0.973	1.969E-39	221	0.511	0.982	6y4zA.pdb.gz
5	AFDB:Q922B1	0.505	0.663	3.018E-31	323	0.304	0.399	Q922B1.pdb.gz	MACD1_MOUSE ADP-ribose glycohydrolase MACROD1 OS=Mus musculus OX=10090 GN=Macrod1 PE=1 SV=2
6	AFDB:Q9BQ69	0.505	0.658	8.736E-31	325	0.301	0.394	Q9BQ69.pdb.gz	MACD1_HUMAN ADP-ribose glycohydrolase MACROD1 OS=Homo sapiens OX=9606 GN=MACROD1 PE=1 SV=2
7	AFDB:Q94JV1	0.432	0.328	2.245E-19	562	0.179	0.135	Q94JV1.pdb.gz	Q94JV1_ARATH Appr-1-p processing enzyme family protein OS=Arabidopsis thaliana OX=3702 GN=At1g69340 PE=1 SV=1
8	AFDB:Q9DBL2	0.441	0.378	5.774E-19	498	0.165	0.141	Q9DBL2.pdb.gz	GDAP2_MOUSE Ganglioside-induced differentiation-associated protein 2 OS=Mus musculus OX=10090 GN=Gdap2 PE=1 SV=1
9	PDB:5cb5R	0.384	0.929	1.553E-18	173	0.184	0.451	5cb5R.pdb.gz	Structural insights into the mechanism of Escherichia coli YmdB: A 2'-O-acetyl-ADP-ribose deacetylase
10	PDB:6fx7A	0.368	0.783	5.055E-13	194	0.127	0.278	6fx7A.pdb.gz	Crystal structure of in vitro evolved Af1521
11	PDB:2lgrA	0.282	0.701	1.155E-4	152	0.056	0.158	2lgrA.pdb.gz
12	PDB:1gytA	0.319	0.273	1.378E-4	503	0.045	0.038	1gytA.pdb.gz	X-Ray Structure of Aminopeptidase a from Escherichia Coli and a Model for the Nucleoprotein Complex in Xer Site-Specific Recombination
13	PDB:6lfqA	0.259	0.563	1.964E-4	169	0.066	0.166	6lfqA.pdb.gz
14	PDB:1njrA	0.246	0.402	2.800E-4	249	0.080	0.137	1njrA.pdb.gz	Structure and mechanism of ADP-ribose-1''-monophosphatase (Appr-1''-pase), a ubiquitous cellular processing enzyme
15	PDB:7epuB	0.245	0.150	3.989E-3	748	0.068	0.039	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
16	PDB:4ksiA	0.289	0.243	4.232E-3	517	0.038	0.031	4ksiA.pdb.gz	Structure of tomato wound-induced leucine aminopeptidase sheds light on substrate specificity.
17	PDB:2ewbA	0.220	0.195	1.088E-1	486	0.045	0.039	2ewbA.pdb.gz	Metal Ion Substitution in the Catalytic Site Greatly Affects the Binding of Sulfhydryl-Containing Compounds to Leucyl Aminopeptidase.
18	AFDB:Q4WEP7	0.122	0.067	5.436E-1	888	0.080	0.038	Q4WEP7.pdb.gz	CHIA1_ASPFU Endochitinase A1 OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=chiA1 PE=3 SV=1
19	AFDB:Q8GYD9	0.099	0.049	1.104	1002	0.106	0.045	Q8GYD9.pdb.gz	SDE3_ARATH Probable RNA helicase SDE3 OS=Arabidopsis thaliana OX=3702 GN=SDE3 PE=1 SV=1
20	AFDB:Q8GUP3	0.093	0.055	2.242	873	0.106	0.052	Q8GUP3.pdb.gz	PDS5C_ARATH Sister chromatid cohesion protein PDS5 homolog C OS=Arabidopsis thaliana OX=3702 GN=PDS5C PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8YFN3	0.0	859	453	1.000	0.938	A0A2R8YFN3_HUMAN Mono-ADP ribosylhydrolase 2 OS=Homo sapiens OX=9606 GN=MACROD2 PE=1 SV=1
2	A1Z1Q3	0.0	875	425	1.000	1.000	MACD2_HUMAN ADP-ribose glycohydrolase MACROD2 OS=Homo sapiens OX=9606 GN=MACROD2 PE=1 SV=2
3	Q3UYG8	0.0	655	475	0.786	0.703	MACD2_MOUSE ADP-ribose glycohydrolase MACROD2 OS=Mus musculus OX=10090 GN=Macrod2 PE=1 SV=1
4	Q922B1	1.80e-84	263	323	0.306	0.402	MACD1_MOUSE ADP-ribose glycohydrolase MACROD1 OS=Mus musculus OX=10090 GN=Macrod1 PE=1 SV=2
5	Q9BQ69	3.76e-82	257	325	0.304	0.397	MACD1_HUMAN ADP-ribose glycohydrolase MACROD1 OS=Homo sapiens OX=9606 GN=MACROD1 PE=1 SV=2
6	Q57ZT5	6.91e-50	171	265	0.191	0.306	Q57ZT5_TRYB2 Macro domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.980 PE=4 SV=1
7	P0A8D6	5.30e-46	158	177	0.202	0.486	YMDB_ECOLI O-acetyl-ADP-ribose deacetylase OS=Escherichia coli (strain K12) OX=83333 GN=ymdB PE=1 SV=1
8	Q8H114	4.26e-40	145	257	0.198	0.327	Q8H114_ARATH Appr-1-p processing enzyme family protein OS=Arabidopsis thaliana OX=3702 GN=At2g40600 PE=1 SV=1
9	Q94JV1	8.05e-37	143	562	0.179	0.135	Q94JV1_ARATH Appr-1-p processing enzyme family protein OS=Arabidopsis thaliana OX=3702 GN=At1g69340 PE=1 SV=1
10	P67343	4.68e-34	130	266	0.169	0.271	ADPRH_STAAM Protein-ADP-ribose hydrolase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=SAV0325 PE=1 SV=1
11	P0DN70	9.25e-31	121	270	0.205	0.322	ADPRH_STRPG Protein-ADP-ribose hydrolase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) OX=160491 GN=SpyM50868 PE=1 SV=1
12	Q9DBL2	5.57e-29	120	498	0.169	0.145	GDAP2_MOUSE Ganglioside-induced differentiation-associated protein 2 OS=Mus musculus OX=10090 GN=Gdap2 PE=1 SV=1
13	Q9NXN4	6.63e-29	120	497	0.158	0.135	GDAP2_HUMAN Ganglioside-induced differentiation-associated protein 2 OS=Homo sapiens OX=9606 GN=GDAP2 PE=1 SV=1
14	Q7JUR6	1.94e-20	95.9	540	0.141	0.111	GDAP2_DROME Protein GDAP2 homolog OS=Drosophila melanogaster OX=7227 GN=Gdap2 PE=2 SV=1
15	Q460N5	1.32e-14	78.6	1801	0.113	0.027	PAR14_HUMAN Protein mono-ADP-ribosyltransferase PARP14 OS=Homo sapiens OX=9606 GN=PARP14 PE=1 SV=3
16	Q02874	3.14e-14	75.9	368	0.122	0.141	H2AY_RAT Core histone macro-H2A.1 OS=Rattus norvegicus OX=10116 GN=Macroh2a1 PE=1 SV=5
17	Q9QZQ8	7.08e-14	74.7	369	0.122	0.141	H2AY_MOUSE Core histone macro-H2A.1 OS=Mus musculus OX=10090 GN=Macroh2a1 PE=1 SV=4
18	Q2EMV9	7.97e-14	76.3	1817	0.118	0.028	PAR14_MOUSE Protein mono-ADP-ribosyltransferase PARP14 OS=Mus musculus OX=10090 GN=Parp14 PE=1 SV=3
19	O75367	1.81e-13	73.6	369	0.120	0.138	H2AY_HUMAN Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=MACROH2A1 PE=1 SV=5
20	O28751	2.39e-13	70.5	192	0.134	0.297	Y1521_ARCFU ADP-ribose glycohydrolase AF_1521 OS=Archaeoglobus fulgidus (strain ATCC 49558 / DSM 4304 / JCM 9628 / NBRC 100126 / VC-16) OX=224325 GN=AF_1521 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01661 Macro	1.1e-37	140.1	Macro domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000217246

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000367292	0.931	Leucine-rich repeat transmembrane protein FLRT3
2	9606.ENSP00000362273	0.916	Poly(ADP-ribose) glycohydrolase ARH3
3	9606.ENSP00000420484	0.812	O-acetyl-ADP-ribose deacetylase 1
4	9606.ENSP00000325618	0.750	Poly [ADP-ribose] polymerase 10
5	9606.ENSP00000384408	0.708	Poly(ADP-ribose) glycohydrolase
6	9606.ENSP00000261888	0.658	Mono [ADP-ribose] polymerase PARP16
7	9606.ENSP00000381740	0.647	Poly [ADP-ribose] polymerase 3
8	9606.ENSP00000282908	0.627	Serine/threonine kinase 32B
9	9606.ENSP00000417480	0.613	Bis(5'-adenosyl)-triphosphatase
10	9606.ENSP00000362352	0.612	Core histone macro-H2A.2
11	9606.ENSP00000231021	0.603	Cadherin-9
12	9606.ENSP00000309117	0.574	RNA binding protein fox-1 homolog 1
13	9606.ENSP00000246841	0.572	Leucine-rich repeat transmembrane protein FLRT1
14	9606.ENSP00000332879	0.572	Leucine-rich repeat transmembrane protein FLRT2
15	9606.ENSP00000456348	0.569	poly(ADP-ribose) polymerase family member 6
16	9606.ENSP00000264463	0.561	Cadherin-10
17	9606.ENSP00000358994	0.561	Unconventional myosin-VI
18	9606.ENSP00000301067	0.550	Histone-lysine N-methyltransferase 2D
19	9606.ENSP00000398837	0.550	Histone-lysine N-methyltransferase 2B
20	9606.ENSP00000281631	0.543	poly(ADP-ribose) polymerase family member 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019213	1.000	deacetylase activity
GO:0016799	1.000	hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0005515	0.983	protein binding
GO:0140293	0.593	ADP-ribosylglutamate hydrolase activity
GO:0140096	0.399	catalytic activity, acting on a protein
GO:0097159	0.343	organic cyclic compound binding
GO:1901363	0.341	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.993	cellular metabolic process
GO:1901564	0.992	organonitrogen compound metabolic process
GO:0006974	0.987	cellular response to DNA damage stimulus
GO:0043412	0.986	macromolecule modification
GO:0006139	0.980	nucleobase-containing compound metabolic process
GO:0055086	0.958	nucleobase-containing small molecule metabolic process
GO:0019538	0.927	protein metabolic process
GO:0036211	0.923	protein modification process
GO:1901657	0.906	glycosyl compound metabolic process
GO:0072521	0.882	purine-containing compound metabolic process
GO:0009116	0.802	nucleoside metabolic process
GO:0042278	0.789	purine nucleoside metabolic process
GO:0050789	0.358	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005730	0.999	nucleolus
GO:0005737	0.501	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.2.-	1.000	Hydrolyzing N-glycosyl compounds.

[back to server]