StarFunc result for job id A2A288

User Input

>input (527 residues)
MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVP
RGSCGVPDSAQRGPGTALEEDFRTLASSLRPIVIDGSNVAMSHGNKETFSCRGIKLAVDW
FRDRGHTYIKVFVPSWRKDPPRADTPIREQHVLAELERQAVLVYTPSRKVHGKRLVCYDD
RYIVKVAYEQDGVIVSNDNYRDLQSENPEWKWFIEQRLLMFSFVNDRFMPPDDPLGRHGP
SLSNFLSRKPKPPEPSWQHCPYGKKCTYGIKCKFYHPERPHHAQLAVADELRAKTGARPG
AGAEEQRPPRAPGGSAGARAAPREPFAHSLPPARGSPDLAALRGSFSRLAFSDDLGPLGP
PLPVPACSLTPRLGGPDWVSAGGRVPGPLSLPSPESQFSPGDLPPPPGLQLQPRGEHRPR
DLHGDLLSPRRPPDDPWARPPRSDRFPGRSVWAEPAWGDGATGGLSVYATEDDEGDARAR
ARIALYSVFPRDQVDRVMAAFPELSDLARLILLVQRCQSAGAPLGKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2A288	1.000	1.000	1.002E-91	527	1.000	1.000	A2A288.pdb.gz	ZC12D_HUMAN Probable ribonuclease ZC3H12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=3
2	AFDB:Q8BIY3	0.496	0.491	6.393E-60	533	0.662	0.655	Q8BIY3.pdb.gz	ZC12D_MOUSE Probable ribonuclease ZC3H12D OS=Mus musculus OX=10090 GN=Zc3h12d PE=2 SV=2
3	AFDB:Q5D1E7	0.393	0.349	1.019E-45	596	0.448	0.396	Q5D1E7.pdb.gz	ZC12A_MOUSE Endoribonuclease ZC3H12A OS=Mus musculus OX=10090 GN=Zc3h12a PE=1 SV=2
4	AFDB:Q5D1E8	0.365	0.323	5.180E-45	599	0.444	0.391	Q5D1E8.pdb.gz	ZC12A_HUMAN Endoribonuclease ZC3H12A OS=Homo sapiens OX=9606 GN=ZC3H12A PE=1 SV=1
5	AFDB:Q9C0D7	0.346	0.210	3.675E-42	883	0.461	0.275	Q9C0D7.pdb.gz	ZC12C_HUMAN Probable ribonuclease ZC3H12C OS=Homo sapiens OX=9606 GN=ZC3H12C PE=1 SV=2
6	PDB:5dizA	0.214	0.236	2.955E-5	474	0.047	0.053	5dizA.pdb.gz	Nuclear Protein-Only Ribonuclease P2 Structure and Biochemical Characterization Provide Insight into the Conserved Properties of tRNA 5' End Processing Enzymes.
7	PDB:3ivtB	0.100	0.118	9.021E-3	400	0.046	0.060	3ivtB.pdb.gz	Crystal structure and functional analysis of homocitrate synthase, an essential enzyme in lysine biosynthesis.
8	PDB:7mq8SL	0.142	0.317	2.365E-2	192	0.049	0.135	7mq8SL.pdb.gz	Nucleolar maturation of the human small subunit processome.
9	PDB:3rqsB	0.130	0.191	7.425E-2	316	0.044	0.073	3rqsB.pdb.gz
10	PDB:7dlwB	0.099	0.118	9.448E-2	419	0.040	0.050	7dlwB.pdb.gz	Dual activities of ACC synthase: Novel clues regarding the molecular evolution of ACS genes.
11	PDB:4gskB	0.128	0.120	1.356E-1	572	0.036	0.033	4gskB.pdb.gz	Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures.
12	PDB:6e2aA	0.109	0.148	1.832E-1	326	0.023	0.037	6e2aA.pdb.gz	Steric hindrance controls pyridine nucleotide specificity of a flavin-dependent NADH:quinone oxidoreductase.
13	PDB:1b8gB	0.139	0.165	1.946E-1	425	0.038	0.047	1b8gB.pdb.gz	Structure of 1-aminocyclopropane-1-carboxylate synthase, a key enzyme in the biosynthesis of the plant hormone ethylene.
14	PDB:7pvnB	0.153	0.092	1.946E-1	990	0.053	0.028	7pvnB.pdb.gz	Structures of UBA6 explain its dual specificity for ubiquitin and FAT10.
15	PDB:4gslA	0.128	0.116	2.067E-1	598	0.036	0.032	4gslA.pdb.gz	Noncanonical E2 recruitment by the autophagy E1 revealed by Atg7-Atg3 and Atg7-Atg10 structures.
16	AFDB:Q9P2N5	0.062	0.037	5.419E-1	1060	0.140	0.070	Q9P2N5.pdb.gz	RBM27_HUMAN RNA-binding protein 27 OS=Homo sapiens OX=9606 GN=RBM27 PE=1 SV=2
17	AFDB:Q86UR5	0.054	0.024	1.337	1692	0.129	0.040	Q86UR5.pdb.gz	RIMS1_HUMAN Regulating synaptic membrane exocytosis protein 1 OS=Homo sapiens OX=9606 GN=RIMS1 PE=1 SV=1
18	AFDB:P39678	0.067	0.046	1.807	833	0.083	0.053	P39678.pdb.gz	MBP1_YEAST Transcription factor MBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MBP1 PE=1 SV=1
19	AFDB:Q8BG36	0.053	0.050	1.807	561	0.125	0.118	Q8BG36.pdb.gz	DMRT2_MOUSE Doublesex- and mab-3-related transcription factor 2 OS=Mus musculus OX=10090 GN=Dmrt2 PE=1 SV=1
20	AFDB:Q6NLP2	0.060	0.060	2.039	520	0.142	0.144	Q6NLP2.pdb.gz	IF31_ARATH Translation initiation factor IF3-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IF3-1 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2A288	0.0	1058	527	1.000	1.000	ZC12D_HUMAN Probable ribonuclease ZC3H12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=3
2	Q8BIY3	0.0	639	533	0.662	0.655	ZC12D_MOUSE Probable ribonuclease ZC3H12D OS=Mus musculus OX=10090 GN=Zc3h12d PE=2 SV=2
3	Q5D1E7	1.61e-119	366	596	0.355	0.314	ZC12A_MOUSE Endoribonuclease ZC3H12A OS=Mus musculus OX=10090 GN=Zc3h12a PE=1 SV=2
4	Q9C0D7	5.41e-118	370	883	0.349	0.208	ZC12C_HUMAN Probable ribonuclease ZC3H12C OS=Homo sapiens OX=9606 GN=ZC3H12C PE=1 SV=2
5	Q5D1E8	3.12e-116	357	599	0.353	0.311	ZC12A_HUMAN Endoribonuclease ZC3H12A OS=Homo sapiens OX=9606 GN=ZC3H12A PE=1 SV=1
6	B7ZBA4	2.88e-101	303	167	0.281	0.886	B7ZBA4_HUMAN Zinc finger CCCH-type containing 12D OS=Homo sapiens OX=9606 GN=ZC3H12D PE=1 SV=1
7	O15037	9.17e-47	175	678	0.176	0.137	KHNYN_HUMAN Protein KHNYN OS=Homo sapiens OX=9606 GN=KHNYN PE=1 SV=3
8	Q6A037	7.29e-45	171	893	0.150	0.088	N4BP1_MOUSE NEDD4-binding protein 1 OS=Mus musculus OX=10090 GN=N4bp1 PE=1 SV=2
9	O75113	1.79e-44	170	896	0.148	0.087	N4BP1_HUMAN NEDD4-binding protein 1 OS=Homo sapiens OX=9606 GN=N4BP1 PE=1 SV=4
10	Q8L7N8	4.2	32.3	375	0.038	0.053	C3H57_ARATH Zinc finger CCCH domain-containing protein 57 OS=Arabidopsis thaliana OX=3702 GN=ZFN3 PE=2 SV=2
11	B4DKM2	9.8	31.2	396	0.044	0.058	B4DKM2_HUMAN Serine/threonine-protein kinase 11-interacting protein OS=Homo sapiens OX=9606 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18561 Regnase_1_C	0.099	23.7	Endoribonuclease Regnase 1/ ZC3H12 C-terminal domain
2	PF11977 RNase_Zc3h12a	2.1e-63	224.2	Zc3h12a-like Ribonuclease NYN domain
3	PF18039 UBA_6	1.5e-08	45.8	UBA-like domain
4	PF00642 zf-CCCH	1.3e+02	13.9	Zinc finger C-x8-C-x5-C-x3-H type (and similar)
5	PF14608 zf-CCCH_2	14	17.7	RNA-binding, Nab2-type zinc finger
6	PF18044 zf-CCCH_4	1.6e+02	13.5	CCCH-type zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386616

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363596	0.918	Cannabinoid receptor 2
2	9606.ENSP00000351642	0.526	Belongs to the cappuccino family
3	9606.ENSP00000268281	0.507	Polyserase-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0003676	0.866	nucleic acid binding
GO:0003723	0.863	RNA binding
GO:0016787	0.605	hydrolase activity
GO:0004540	0.389	ribonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0048519	0.914	negative regulation of biological process
GO:1901987	0.891	regulation of cell cycle phase transition
GO:0045786	0.882	negative regulation of cell cycle
GO:0009987	0.874	cellular process
GO:1902806	0.859	regulation of cell cycle G1/S phase transition
GO:1901990	0.797	regulation of mitotic cell cycle phase transition
GO:0051128	0.792	regulation of cellular component organization
GO:0010948	0.755	negative regulation of cell cycle process
GO:0045930	0.749	negative regulation of mitotic cell cycle
GO:1901988	0.749	negative regulation of cell cycle phase transition
GO:1901991	0.699	negative regulation of mitotic cell cycle phase transition
GO:2000045	0.675	regulation of G1/S transition of mitotic cell cycle
GO:0040008	0.654	regulation of growth
GO:1902807	0.621	negative regulation of cell cycle G1/S phase transition
GO:0044238	0.555	primary metabolic process
GO:0001558	0.555	regulation of cell growth
GO:0071704	0.529	organic substance metabolic process
GO:0006807	0.514	nitrogen compound metabolic process
GO:0044237	0.505	cellular metabolic process
GO:0019222	0.473	regulation of metabolic process
GO:0090304	0.450	nucleic acid metabolic process
GO:0010468	0.447	regulation of gene expression
GO:0045926	0.434	negative regulation of growth
GO:2000134	0.412	negative regulation of G1/S transition of mitotic cell cycle
GO:0016070	0.401	RNA metabolic process
GO:0031323	0.383	regulation of cellular metabolic process
GO:0010608	0.334	post-transcriptional regulation of gene expression
GO:0010605	0.323	negative regulation of macromolecule metabolic process
GO:0080090	0.313	regulation of primary metabolic process
GO:0051171	0.313	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0036464	0.997	cytoplasmic ribonucleoprotein granule
GO:0000932	0.964	P-body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.605	Hydrolases.
EC:3.1.-.-	0.392	Acting on ester bonds.

[back to server]