StarFunc result for job id A2A2Z9

User Input

>input (1011 residues)
MRKLLSFGRRLGQALLSSMDQEYAGRGYHIRDWELRKIHRAAIKGDAAEVEHCLTRRFRD
LDVRDRKDRTVLHLACAHGRVQVVTLLLDRKCQINICDRLNRTPLMKAVHCQEEACAIIL
LKRGANPNIKDIYGNTALHYAVYNEGTSLAERLLSHHANIEALNKEGNTPLLFAINSRRQ
HMVEFLLKNQANIHAVDNFKRTALILAVQHNLSSIVTLLLQQNIHISSQDMFGQTAEDYA
FCCDLRSIQQQILEHKNKMLKNHLRNDNQETAAMKPENLKKRKKRKKLKKRKEGAKAEHN
LKVASEEKQERLERSENKQPQDSQSYGKKKDEMFGNFMLKRDIAMLKEELYAIKNDSLRK
EKKYIQEIKSITEINANFEKSVRLNEEMITKKVAQYSQQLNDLKAENARLNSKLEKEKHN
KERLEAEVESLHSNLATAINEYNEILERKDLELVLWRADDVSRHETMGSNISQLTDKNEL
LTEQVHKARVKFNTLKGKLRETRDALREKTLALESVQLDLKQAQHRIKEMKQMHPNGEAK
ESQSIGKQNSSEERIRQRELENLLLERQLEDARKEGDNKEIVINIHRDCLENGKEDLLEE
RNKELMNEYNYLKEKLLQYEKEKAEREVIVREFQEELVDHLKKFSMSESPLEGTSHCHIN
LDETWTSKKKLFQVEIQPEEKHEEFRKVFELISLLNYTADQIRKKNRELEEEATGYKKCL
EMTINMLNAFANEDFSCHGDLNTDQLKMDILFKKLKQKFDDLMAEKEAVSSKCVNLAKDN
EVLHQELLSMGKVQEKCEKLEKDKKMLEEKVLNLKTHMEKDMVELGKVQEYKSELDERAM
QAIEKLEEIHLQKQAEYEKQLEQLNKDNTASLKKKELTLKDVECKFSKMKTAYEDVTTEL
EEYKEAFAVALKANSSMSEKITKSDKKIAVISTKLFMEKERMEYFLSTLPMRPDPELPCV
ENLNSIELNRKYIPKMAIRIPTSNPQTSNNCKNSLTELLLRWALAPIYFLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5TYW2	0.252	0.308	1.677E-38	823	0.329	0.405	Q5TYW2.pdb.gz	A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens OX=9606 GN=ANKRD20A1 PE=2 SV=1
2	AFDB:Q9UPS8	0.183	0.109	5.443E-32	1710	0.468	0.277	Q9UPS8.pdb.gz	ANR26_HUMAN Ankyrin repeat domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ANKRD26 PE=1 SV=4
3	AFDB:A0JP26	0.246	0.423	6.214E-24	581	0.154	0.269	A0JP26.pdb.gz	POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens OX=9606 GN=POTEB3 PE=1 SV=2
4	AFDB:A5A3E0	0.234	0.221	6.239E-23	1075	0.121	0.113	A5A3E0.pdb.gz	POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens OX=9606 GN=POTEF PE=1 SV=2
5	AFDB:Q811D2	0.170	0.109	7.625E-23	1581	0.373	0.238	Q811D2.pdb.gz	ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus OX=10090 GN=Ankrd26 PE=1 SV=2
6	AFDB:A1A5B0	0.223	0.718	1.139E-22	309	0.127	0.414	A1A5B0.pdb.gz	A1A5B0_HUMAN ANKRD36 protein OS=Homo sapiens OX=9606 GN=ANKRD36 PE=1 SV=1
7	AFDB:Q9D504	0.232	0.815	2.087E-21	279	0.106	0.384	Q9D504.pdb.gz	ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus OX=10090 GN=Ankrd7 PE=2 SV=2
8	AFDB:C9JIJ7	0.217	0.789	9.469E-19	263	0.099	0.380	C9JIJ7.pdb.gz	C9JIJ7_HUMAN Ankyrin repeat domain 7 OS=Homo sapiens OX=9606 GN=ANKRD7 PE=1 SV=2
9	AFDB:Q6NSI1	0.169	0.522	3.012E-17	321	0.090	0.283	Q6NSI1.pdb.gz	AR26L_HUMAN Putative ankyrin repeat domain-containing protein 26-like protein OS=Homo sapiens OX=9606 GN=ANKRD26P1 PE=5 SV=2
10	AFDB:Q69ZU8	0.212	0.296	9.622E-15	712	0.074	0.105	Q69ZU8.pdb.gz	ANKR6_MOUSE Ankyrin repeat domain-containing protein 6 OS=Mus musculus OX=10090 GN=Ankrd6 PE=1 SV=2
11	PDB:8cs9A	0.213	0.270	8.172E-13	796	0.063	0.080	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:2dvwA	0.206	0.843	1.492E-12	229	0.053	0.236	2dvwA.pdb.gz
13	PDB:4oauC	0.207	0.296	1.924E-11	692	0.063	0.092	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
14	PDB:6v9hC	0.190	0.679	2.246E-10	270	0.041	0.152	6v9hC.pdb.gz
15	PDB:5vkqA	0.190	0.131	5.267E-10	1499	0.060	0.041	5vkqA.pdb.gz
16	PDB:1wg0A	0.197	0.744	1.845E-9	243	0.045	0.189	1wg0A.pdb.gz
17	PDB:6aunA	0.181	0.279	5.030E-9	618	0.055	0.091	6aunA.pdb.gz
18	PDB:6jd6B	0.148	0.741	3.555E-8	192	0.041	0.214	6jd6B.pdb.gz
19	PDB:1bd8A	0.142	0.843	9.218E-8	156	0.038	0.244	1bd8A.pdb.gz
20	PDB:6dmwA	0.178	0.280	2.390E-7	631	0.051	0.082	6dmwA.pdb.gz	Structural insights on TRPV5 gating by endogenous modulators.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UPS8	1.17e-162	523	1710	0.340	0.201	ANR26_HUMAN Ankyrin repeat domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ANKRD26 PE=1 SV=4
2	Q5TYW2	1.39e-106	353	823	0.161	0.198	A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens OX=9606 GN=ANKRD20A1 PE=2 SV=1
3	Q811D2	1.77e-98	343	1581	0.262	0.168	ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus OX=10090 GN=Ankrd26 PE=1 SV=2
4	A1A5B0	7.27e-71	240	309	0.126	0.411	A1A5B0_HUMAN ANKRD36 protein OS=Homo sapiens OX=9606 GN=ANKRD36 PE=1 SV=1
5	Q8N2N9	5.40e-67	248	1353	0.120	0.089	AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens OX=9606 GN=ANKRD36B PE=1 SV=4
6	A0JP26	6.28e-67	238	581	0.129	0.224	POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens OX=9606 GN=POTEB3 PE=1 SV=2
7	P0CG39	1.76e-65	242	1038	0.130	0.126	POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens OX=9606 GN=POTEJ PE=3 SV=1
8	A5A3E0	1.97e-65	242	1075	0.128	0.120	POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens OX=9606 GN=POTEF PE=1 SV=2
9	Q6S8J3	2.56e-65	241	1075	0.128	0.120	POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens OX=9606 GN=POTEE PE=2 SV=3
10	P0CG38	2.94e-65	241	1075	0.129	0.121	POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens OX=9606 GN=POTEI PE=3 SV=1
11	Q9D504	7.15e-65	222	279	0.104	0.376	ANKR7_MOUSE Ankyrin repeat domain-containing protein 7 OS=Mus musculus OX=10090 GN=Ankrd7 PE=2 SV=2
12	A0A140VJE5	4.56e-57	199	254	0.102	0.406	A0A140VJE5_HUMAN Testicular tissue protein Li 19 OS=Homo sapiens OX=9606 PE=2 SV=1
13	Q92527	4.56e-57	199	254	0.102	0.406	ANKR7_HUMAN Ankyrin repeat domain-containing protein 7 OS=Homo sapiens OX=9606 GN=ANKRD7 PE=2 SV=3
14	C9JIJ7	2.04e-56	198	263	0.102	0.392	C9JIJ7_HUMAN Ankyrin repeat domain 7 OS=Homo sapiens OX=9606 GN=ANKRD7 PE=1 SV=2
15	Q6NSI1	2.12e-56	200	321	0.098	0.308	AR26L_HUMAN Putative ankyrin repeat domain-containing protein 26-like protein OS=Homo sapiens OX=9606 GN=ANKRD26P1 PE=5 SV=2
16	Q54KA7	1.34e-21	103	986	0.069	0.071	SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum OX=44689 GN=secG PE=2 SV=1
17	Q8GZ22	2.83e-18	87.4	240	0.059	0.250	Q8GZ22_ARATH Ankyrin repeat family protein OS=Arabidopsis thaliana OX=3702 GN=At2g03430 PE=1 SV=1
18	H0YNH8	1.10e-17	91.3	1401	0.057	0.041	H0YNH8_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA PE=1 SV=1
19	Q9BZF9	3.92e-17	89.7	1416	0.056	0.040	UACA_HUMAN Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA PE=1 SV=2
20	Q12955	9.78e-17	88.6	4377	0.050	0.012	ANK3_HUMAN Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	2.3e-17	73.8	Ankyrin repeat
2	PF12796 Ank_2	1.9e-22	90.9	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	5.7e-13	58.6	Ankyrin repeat
4	PF13637 Ank_4	3.5e-22	89.7	Ankyrin repeats (many copies)
5	PF13857 Ank_5	1e-20	84.8	Ankyrin repeats (many copies)
6	PF14915 CCDC144C	1.9e-93	324.5	CCDC144C protein coiled-coil region
7	PF12001 DUF3496	1.7e-31	120.2	Domain of unknown function (DUF3496)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000290943

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000392368	0.595	Uncharacterized protein CCDC198
2	9606.ENSP00000292894	0.564	THAP domain containing 8
3	9606.ENSP00000361857	0.527	Zinc finger protein Rlf

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0009987	0.763	cellular process
GO:0048518	0.454	positive regulation of biological process
GO:0048522	0.391	positive regulation of cellular process
GO:0019222	0.322	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.998	intracellular organelle
GO:0005634	0.977	nucleus
GO:0016020	0.954	membrane
GO:0043232	0.941	intracellular non-membrane-bounded organelle
GO:0005886	0.699	plasma membrane
GO:0005737	0.588	cytoplasm
GO:0031981	0.533	nuclear lumen
GO:0005829	0.304	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]