StarFunc result for job id A2AJT9

User Input

>input (711 residues)
MARSRSRSPRWKHRSLSPVPRNAEHYKQRHSHGHYGCEYRKDPKRPVAWRMDSEKHGQSK
PRIPSRGNIYYQSYEHRSPSPNIRNSLENVYMYKPHRGYSPGRGDSNRRAQYMPKYSEGI
PYKEHERNSYPQKVQGGHSPDDHRVRGSGKGGKPPQRSIADSFRFEGKWHEDELRHQRIQ
EEKYSQSTRRGSEDFETRSSFQKRYPEDRDFRKYGHTSKRPKDVERYESREPARNPKWKP
EHSLPPYQEDTDQWNLGPQTYRHAEREHPETSSATKVSYDYRHKRPKLLDGDQDFSDGRT
QKYCKEEDRKYSFQKGPLNRELDCFNTGRGRETQDGQVKEPFKPSKKDSIACTYSNKNDV
DLRSSNDKWKEKIKKEGDCRKESNSSSNQLDKSQKLPDVKPSPINLRKKSLTVKVDVKKT
VDTFRVASSYSTERQMSHDLVAVGRKSENFHPVFEHLDSTQNTENKPTGEFAQEIITIIH
QVKANYFPSPGITLHERFSTMQDIHKADVNEIPLNSDPEIHRRIDMSLAELQSKQAVIYE
SEQTLIKIIDPNDLRHDIERRRKERLQNEDEHIFHIASAAERDDQNSSFSKVKNVHTDGF
QKPTHFIKSNFRKCIEKPYMNYTTQRKDIITHKPFEVEGNHRNTRVRPFKSNFRGGRCQP
NYKSGLVQKSLYIQAKYQRLRFTGPRGFITHKFRERLMRKKKEYTDVATGI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NYF8	0.098	0.084	4.137E-12	920	0.200	0.154	Q9NYF8.pdb.gz	BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2
2	AFDB:Q9Y2W1	0.059	0.046	2.200E-10	955	0.242	0.180	Q9Y2W1.pdb.gz	TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2
3	AFDB:Q3TGQ4	0.049	0.044	5.744E-6	858	0.145	0.120	Q3TGQ4.pdb.gz	Q3TGQ4_MOUSE Ribosomal protein eL8/eL30/eS12/Gadd45 domain-containing protein OS=Mus musculus OX=10090 GN=Secisbp2 PE=2 SV=1
4	AFDB:J9VE33	0.056	0.041	9.845E-6	1094	0.122	0.080	J9VE33.pdb.gz	CRZ1_CRYNH Transcriptional regulator CRZ1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CRZ1 PE=1 SV=1
5	AFDB:Q57Y22	0.051	0.046	1.289E-5	832	0.131	0.112	Q57Y22.pdb.gz	Q57Y22_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.350 PE=4 SV=1
6	AFDB:A0A1D8PFD3	0.051	0.041	1.578E-5	1001	0.149	0.106	A0A1D8PFD3.pdb.gz	A0A1D8PFD3_CANAL Snt1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNT1 PE=4 SV=1
7	AFDB:Q96T21	0.058	0.051	2.065E-5	854	0.145	0.121	Q96T21.pdb.gz	SEBP2_HUMAN Selenocysteine insertion sequence-binding protein 2 OS=Homo sapiens OX=9606 GN=SECISBP2 PE=1 SV=2
8	AFDB:M9PB92	0.045	0.035	3.309E-5	1062	0.131	0.088	M9PB92.pdb.gz	M9PB92_DROME CCR4-NOT transcription complex subunit 4, isoform K OS=Drosophila melanogaster OX=7227 GN=Cnot4 PE=1 SV=1
9	AFDB:A0A1D8PGE6	0.053	0.047	3.786E-5	838	0.124	0.105	A0A1D8PGE6.pdb.gz	A0A1D8PGE6_CANAL Hap42p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HAP42 PE=4 SV=1
10	AFDB:O43019	0.072	0.067	4.332E-5	793	0.146	0.131	O43019.pdb.gz	SRE2_SCHPO Putative transcription factor sre2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sre2 PE=1 SV=1
11	PDB:7mqaNA	0.037	0.079	2.138E-1	295	0.055	0.132	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:6yxxAf	0.040	0.146	1.318	139	0.027	0.137	6yxxAf.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
13	PDB:6i9r6	0.038	0.063	1.725	354	0.023	0.045	6i9r6.pdb.gz	Inhibition of mitochondrial translation suppresses glioblastoma stem cell growth.
14	PDB:7mqaSS	0.061	0.101	1.845	350	0.044	0.089	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7o9kI	0.040	0.111	3.383	212	0.024	0.080	7o9kI.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
16	PDB:4v8mBT	0.047	0.133	4.140	199	0.035	0.126	4v8mBT.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
17	PDB:7o9k6	0.039	0.065	4.140	331	0.020	0.042	7o9k6.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
18	PDB:5mrc8	0.045	0.127	7.591	199	0.042	0.151	5mrc8.pdb.gz	The structure of the yeast mitochondrial ribosome.
19	PDB:5z56A	0.044	0.018	7.591	2232	0.025	0.008	5z56A.pdb.gz	Structure of the human activated spliceosome in three conformational states.
20	PDB:5z57A	0.044	0.020	7.591	1978	0.025	0.009	5z57A.pdb.gz	Structure of the human activated spliceosome in three conformational states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q569Z6	4.37e-20	97.8	951	0.089	0.066	TR150_MOUSE Thyroid hormone receptor-associated protein 3 OS=Mus musculus OX=10090 GN=Thrap3 PE=1 SV=1
2	Q9Y2W1	8.75e-20	97.1	955	0.096	0.071	TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2
3	A0A3B3ITZ9	1.22e-19	96.3	910	0.096	0.075	A0A3B3ITZ9_HUMAN Thyroid hormone receptor associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=1
4	Q8K019	7.69e-14	77.8	919	0.070	0.054	BCLF1_MOUSE Bcl-2-associated transcription factor 1 OS=Mus musculus OX=10090 GN=Bclaf1 PE=1 SV=2
5	E9PK91	5.82e-13	74.7	871	0.070	0.057	E9PK91_HUMAN BCL2 associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=1
6	Q9NYF8	6.58e-13	74.7	920	0.070	0.054	BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2
7	E9PKI6	1.41e-12	73.6	752	0.070	0.066	E9PKI6_HUMAN BCL2 associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=1
8	E9PK09	1.54e-10	67.0	725	0.069	0.068	E9PK09_HUMAN BCL2 associated transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=8
9	Q10435	1.8	34.7	1647	0.028	0.012	YDE1_SCHPO Probable ubiquitin fusion degradation protein C12B10.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC12B10.01c PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15440 THRAP3_BCLAF1	2.2e-217	735.9	THRAP3/BCLAF1 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005593188.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005593096.1	0.572	Belongs to the alpha-carbonic anhydrase family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	0.995	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0009987	0.974	cellular process
GO:0019222	0.870	regulation of metabolic process
GO:0048518	0.827	positive regulation of biological process
GO:0031323	0.824	regulation of cellular metabolic process
GO:0080090	0.818	regulation of primary metabolic process
GO:0051171	0.818	regulation of nitrogen compound metabolic process
GO:0060255	0.782	regulation of macromolecule metabolic process
GO:0048522	0.711	positive regulation of cellular process
GO:0010468	0.709	regulation of gene expression
GO:0019219	0.707	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.690	regulation of RNA metabolic process
GO:0010556	0.685	regulation of macromolecule biosynthetic process
GO:0031326	0.679	regulation of cellular biosynthetic process
GO:2001141	0.656	regulation of RNA biosynthetic process
GO:0071704	0.634	organic substance metabolic process
GO:0044237	0.632	cellular metabolic process
GO:0006807	0.600	nitrogen compound metabolic process
GO:0044238	0.580	primary metabolic process
GO:0009893	0.579	positive regulation of metabolic process
GO:0006355	0.574	regulation of DNA-templated transcription
GO:0051173	0.559	positive regulation of nitrogen compound metabolic process
GO:0010604	0.556	positive regulation of macromolecule metabolic process
GO:0031325	0.548	positive regulation of cellular metabolic process
GO:0045935	0.540	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.446	positive regulation of RNA metabolic process
GO:0010557	0.445	positive regulation of macromolecule biosynthetic process
GO:0031328	0.427	positive regulation of cellular biosynthetic process
GO:1902680	0.422	positive regulation of RNA biosynthetic process
GO:0043170	0.408	macromolecule metabolic process
GO:0045893	0.406	positive regulation of DNA-templated transcription
GO:0034641	0.378	cellular nitrogen compound metabolic process
GO:1901360	0.371	organic cyclic compound metabolic process
GO:0006139	0.343	nucleobase-containing compound metabolic process
GO:0048519	0.317	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.948	cytoplasm
GO:0005829	0.732	cytosol
GO:0016604	0.687	nuclear body
GO:0016607	0.506	nuclear speck
GO:0032991	0.483	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]