StarFunc result for job id A2PYH4

User Input

>input (1435 residues)
MLKSNDCLFSLENLFFEKPDEVENHPDNEKSLDWFLPPAPLISEIPDTQELEEELESHKL
LGQEKRPKMLTSNLKITNEDTNYISLTQKFQFAFPSDKYEQDDLNLEGVGNNDLSHIAGK
LTYASQKYKNHIGTEIAPEKSVPDDTKLVNFAEDKGESTSVFRKRLFKISDNIHGSAYSN
DNELDSHIGSVKIVQTEMNKGKSRNYSNSKQKFQYSANVFTANNAFSASEIGEGMFKAPS
FSVAFQPHDIQEVTENGLGSLKAVTEIPAKFRSIFKEFPYFNYIQSKAFDDLLYTDRNFV
ICAPTGSGKTVVFELAITRLLMEVPLPWLNIKIVYMAPIKALCSQRFDDWKEKFGPIGLN
CKELTGDTVMDDLFEIQHAHIIMTTPEKWDSMTRKWRDNSLVQLVRLFLIDEVHIVKDEN
RGPTLEVVVSRMKTVQSVSQTLKNTSTAIPMRFVAVSATIPNAEDIAEWLSDGERPAVCL
KMDESHRPVKLQKVVLGFPCSSNQTEFKFDLTLNYKIASVIQMYSDQKPTLVFCATRKGV
QQAASVLVKDAKFIMTVEQKQRLQKYAYSVRDSKLRDILKDGAAYHHAGMELSDRKVVEG
AFTVGDLPVLFTTSTLAMGVNLPAHLVVIKSTMHYAGGLFEEYSETDILQMIGRAGRPQF
DTTATAVIMTRLSTRDKYIQMLACRDTVESSLHRHLIEHLNAEIVLHTITDVNIAVEWIR
STLLYIRALKNPSHYGFASGLNKDGIEAKLQELCLKNLNDLSSLDLIKMDEGVNFKPTEA
GRLMAWYYITFETVKKFYTISGKETLSDLVTLIAGCKEFLDIQLRINEKKTLNTLNKDPN
RITIRFPMEGRIKTREMKVNCLIQAQLGCIPIQDFALTQDTAKIFRHGSRITRWLSDFVA
AQEKKFAVLLNSLILAKCFRCKLWENSLHVSKQLEKIGITLSNAIVNAGLTSFKKIEETD
ARELELILNRHPPFGTQIKETVMYLPKYELKVEQITRYSDTTAEILVTVILRNFEQLQTK
RTASDSHYVTLIIGDADNQVVYLHKITDSVLLKAGSWAKKIAVKRALKSEDLSINLISSE
FVGLDIQQKLTVFYLEPKRFGNQITMQRKSETQISHSKHSDISTIAGPNKGTTASKKPGN
RECNHLCKSKHTCGHDCCKIGVAQKSEIKESTISSYLSDLRNRNAVSSVPPVKRLKIQMN
KSQSVDLKEFGFTPKPSLPSISRSEYLNISELPIMEQWDQPEIYGKVRQEPSEYQDKEVL
NVNFELGNEVWDDFDDENLEVTSFSTDTEKTKISGFGNTLSSSTRGSKLPLQESKSKFQR
EMSNSFVSSHEMSDISLSNSAMPKFSASSMTKLPQQAGNAVIVHFQERKPQNLSPEIEKQ
CFTFSEKNPNSSNYKKVDFFIRNSECKKEVDFSMYHPDDEADEMKSLLGIFDGIF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3Z4R1	0.691	0.691	0.000	1434	0.769	0.769	D3Z4R1.pdb.gz	HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus OX=10090 GN=Hfm1 PE=3 SV=2
2	PDB:6qw65B	0.508	0.371	2.826E-57	2001	0.172	0.123	6qw65B.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
3	PDB:5dcaA	0.519	0.388	1.641E-56	1948	0.160	0.118	5dcaA.pdb.gz
4	PDB:3jcmN	0.489	0.421	3.808E-53	1686	0.163	0.139	3jcmN.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
5	PDB:6ro1A	0.247	0.373	5.742E-22	919	0.100	0.157	6ro1A.pdb.gz	The MTR4 helicase recruits nuclear adaptors of the human RNA exosome using distinct arch-interacting motifs.
6	PDB:6d6qM	0.315	0.586	7.637E-22	709	0.098	0.199	6d6qM.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
7	PDB:2xgjB	0.273	0.470	1.797E-21	777	0.091	0.167	2xgjB.pdb.gz	Structural Analysis Reveals the Characteristic Features of Mtr4, a Dexh Helicase Involved in Nuclear RNA Processing and Surveillance.
8	PDB:4xgtA	0.252	0.366	3.951E-20	961	0.106	0.158	4xgtA.pdb.gz
9	PDB:6iegA	0.241	0.379	8.866E-20	872	0.098	0.162	6iegA.pdb.gz	NRDE2 negatively regulates exosome functions by inhibiting MTR4 recruitment and exosome interaction.
10	PDB:7qdyA	0.246	0.297	3.520E-19	1169	0.109	0.134	7qdyA.pdb.gz	The human SKI complex regulates channeling of ribosome-bound RNA to the exosome via an intrinsic gatekeeping mechanism.
11	PDB:7z4yB	0.246	0.367	1.332E-18	930	0.100	0.155	7z4yB.pdb.gz
12	AFDB:Q09811	0.215	0.231	1.265E-15	1328	0.142	0.154	Q09811.pdb.gz	HUS2_SCHPO ATP-dependent DNA helicase hus2/rqh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rqh1 PE=1 SV=1
13	AFDB:Q9JIK5	0.212	0.340	1.605E-15	851	0.087	0.147	Q9JIK5.pdb.gz	DDX21_MOUSE Nucleolar RNA helicase 2 OS=Mus musculus OX=10090 GN=Ddx21 PE=1 SV=3
14	AFDB:F4K2E9	0.211	0.237	2.222E-10	1255	0.080	0.092	F4K2E9.pdb.gz	PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana OX=3702 GN=CUV PE=1 SV=1
15	AFDB:F4IDQ6	0.243	0.225	2.956E-10	1576	0.109	0.100	F4IDQ6.pdb.gz	NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana OX=3702 GN=NIH PE=1 SV=1
16	AFDB:Q9SQV1	0.207	0.266	2.511E-9	1088	0.077	0.101	Q9SQV1.pdb.gz	RH40_ARATH DEAD-box ATP-dependent RNA helicase 40 OS=Arabidopsis thaliana OX=3702 GN=RH40 PE=2 SV=1
17	AFDB:Q9Y4B4	0.174	0.171	8.241E-9	1467	0.118	0.115	Q9Y4B4.pdb.gz	ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens OX=9606 GN=RAD54L2 PE=1 SV=4
18	AFDB:Q9VGI8	0.188	0.182	1.206E-8	1487	0.131	0.126	Q9VGI8.pdb.gz	BLM_DROME RecQ-like DNA helicase Blm OS=Drosophila melanogaster OX=7227 GN=Blm PE=1 SV=1
19	AFDB:Q9UNY4	0.178	0.213	2.237E-8	1162	0.088	0.108	Q9UNY4.pdb.gz	TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens OX=9606 GN=TTF2 PE=1 SV=2
20	AFDB:Q7KU24	0.177	0.139	6.070E-8	1883	0.139	0.106	Q7KU24.pdb.gz	CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster OX=7227 GN=Chd1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z4R1	0.0	2282	1434	0.769	0.770	HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus OX=10090 GN=Hfm1 PE=3 SV=2
2	Q5D892	7.23e-174	551	1133	0.241	0.305	MER3_ARATH DExH-box ATP-dependent RNA helicase DExH17 OS=Arabidopsis thaliana OX=3702 GN=MER3 PE=2 SV=1
3	B6DMK2	5.20e-169	541	1205	0.236	0.281	MER3_ORYSJ ATP-dependent DNA helicase MER3 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=MER3 PE=2 SV=1
4	P51979	2.67e-138	457	1187	0.190	0.229	HFM1_YEAST ATP-dependent DNA helicase MER3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HFM1 PE=1 SV=3
5	Q381X2	7.15e-118	405	1408	0.208	0.212	Q381X2_TRYB2 RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6260 PE=4 SV=1
6	Q9FNQ1	3.58e-97	348	2157	0.160	0.106	DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana OX=3702 GN=BRR2C PE=2 SV=1
7	Q9SYP1	5.73e-95	342	2171	0.180	0.119	DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana OX=3702 GN=BRR2A PE=1 SV=1
8	Q8N3C0	5.46e-94	338	2202	0.163	0.106	ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens OX=9606 GN=ASCC3 PE=1 SV=3
9	A0A494C1A5	1.66e-92	330	1375	0.190	0.199	A0A494C1A5_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase (Fragment) OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=1
10	O60072	2.80e-92	333	1935	0.157	0.117	SLH1_SCHPO RQC trigger complex helicase slh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=slh1 PE=1 SV=1
11	O48534	1.52e-91	331	2172	0.176	0.116	DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana OX=3702 GN=BRR2B PE=2 SV=1
12	Q9VUV9	1.53e-91	331	2142	0.181	0.121	U520_DROME U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Drosophila melanogaster OX=7227 GN=Brr2 PE=2 SV=4
13	Q961L2	1.76e-91	316	774	0.138	0.256	Q961L2_DROME GH18520p OS=Drosophila melanogaster OX=7227 GN=obe PE=2 SV=1
14	O75643	2.67e-91	330	2136	0.190	0.128	U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2
15	P53327	1.53e-90	327	1967	0.153	0.112	SLH1_YEAST RQC trigger complex helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLH1 PE=1 SV=2
16	Q9VF56	1.00e-89	325	2183	0.159	0.104	Q9VF56_DROME Obelus OS=Drosophila melanogaster OX=7227 GN=obe PE=1 SV=2
17	Q9UT24	3.61e-86	314	2176	0.156	0.103	BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=brr2 PE=1 SV=1
18	P32639	7.13e-79	291	2163	0.159	0.105	BRR2_YEAST Pre-mRNA-splicing helicase BRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BRR2 PE=1 SV=2
19	Q582D6	7.18e-74	275	2237	0.149	0.096	Q582D6_TRYB2 ATP-dependent RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.290 PE=4 SV=1
20	Q8CGS6	1.13e-33	144	2544	0.086	0.049	DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus OX=10090 GN=Polq PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	41	15.9	AAA domain
2	PF00270 DEAD	4.5e-22	90.2	DEAD/DEAH box helicase
3	PF00271 Helicase_C	2.4e-06	39.2	Helicase conserved C-terminal domain
4	PF17209 Hfq	4e+02	12.1	Hfq protein
5	PF04851 ResIII	1.6e-08	46.3	Type III restriction enzyme, res subunit
6	PF02889 Sec63	7.8e-46	167.9	Sec63 Brl domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359454

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263187	0.968	MutS protein homolog 4
2	9606.ENSP00000364855	0.925	MutS protein homolog 5
3	9606.ENSP00000360310	0.866	Meiotic recombination protein SPO11
4	9606.ENSP00000307853	0.856	Crossover junction endonuclease MUS81
5	9606.ENSP00000240488	0.853	Meiotic nuclear division protein 1 homolog
6	9606.ENSP00000379226	0.837	Testis-expressed protein 11
7	9606.ENSP00000348020	0.817	DNA mismatch repair protein Mlh3
8	9606.ENSP00000409896	0.812	E3 ubiquitin-protein ligase CCNB1IP1
9	9606.ENSP00000460348	0.809	Pre-mRNA-processing-splicing factor 8
10	9606.ENSP00000357612	0.782	Zinc transporter ZIP1
11	9606.ENSP00000260210	0.776	BUD13 homolog
12	9606.ENSP00000314505	0.766	DNA helicase MCM9
13	9606.ENSP00000301305	0.759	Zinc transporter ZIP4
14	9606.ENSP00000333097	0.751	Factor in the germline alpha
15	9606.ENSP00000231790	0.744	DNA mismatch repair protein Mlh1
16	9606.ENSP00000351185	0.743	DNA replication ATP-dependent helicase/nuclease DNA2
17	9606.ENSP00000166345	0.741	Pachytene checkpoint protein 2 homolog
18	9606.ENSP00000298681	0.709	Zinc transporter ZIP2
19	9606.ENSP00000331901	0.700	Elongation factor 1-gamma
20	9606.ENSP00000368164	0.694	DNA helicase MCM8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003678	1.000	DNA helicase activity
GO:0003676	0.995	nucleic acid binding
GO:0008186	0.923	ATP-dependent activity, acting on RNA
GO:0140098	0.919	catalytic activity, acting on RNA
GO:0003724	0.888	RNA helicase activity
GO:0003723	0.624	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0090304	0.991	nucleic acid metabolic process
GO:0007127	0.972	meiosis I
GO:0140527	0.970	reciprocal homologous recombination
GO:0007131	0.937	reciprocal meiotic recombination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0043232	0.978	intracellular non-membrane-bounded organelle
GO:0032991	0.974	protein-containing complex
GO:0005694	0.787	chromosome
GO:0016604	0.496	nuclear body
GO:0005737	0.403	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.4.13	0.888	RNA helicase.

[back to server]