StarFunc result for job id A2RRP1

User Input

>input (2371 residues)
MAAPESGPALSPGTAEGEEETILYDLLVNTEWPPETEVQPRGNQKHGASFIITKAIRDRL
LFLRQYIWYSPAPFLLPDGLVRLVNKQINWHLVLASNGKLLAAVQDQCVEIRSAKDDFTS
IIGKCQVPKDPKPQWRRVAWSYDCTLLAYAESTGTVRVFDLMGSELFVISPASSFIGDLS
YAIAGLIFLEYKASAQWSAELLVINYRGELRSYLVSVGTNQSYQESHCFSFSSHYPHGIN
TAIYHPGHRLLLVGGCETAEVGMSKASSCGLSAWRVLSGSPYYKQVTNGGDGVTAVPKTL
GLLRMLSVKFYSRQGQEQDGIFKMSLSPDGMLLAAIHFSGKLSIWAIPSLKQQGEWGQNE
QPGYDDLNPDWRLSTEKRKKIKDKESFYPLIDVNWWADSAVTLARCSGALTVSSVKTLKN
LLGKSCEWFEPSPQVTATHDGGFLSLECEIKLAPKRSRLETRAGEEDEGEEDSDSDYEIS
AKARYFGYIKQGLYLVTEMERFAPPRKRPRTITKNYRLVSLRSTTPEELYQRKIESEEYE
EALSLAHTYGLDTDLVYQRQWRKSAVNVASIQNYLSKIKKRSWVLHECLERVPENVDAAK
ELLQYGLKGTDLEALLAIGKGADDGRFTLPGEIDIDSISYEELSPPDEEPAKNKKEKELK
KRQELLKLVNFSKLTLEQKELCRCRRKLLTYLDRLATYEEILGVPHASEQRYDAEFFKKF
RNQNIVLSARTYAQESNVQALEILFTYHGSDLLPHRLAILSNFPETTSPHEYSVLLPEAC
FNGDSLMIIPWHEHKHRAKDWCEELACRMVVEPNLQDESEFLYAAQPELLRFRMTQLTVE
KVMDWYQTRAEEIEHYARQVDCALSLIRLGMERNIPGLLVLCDNLVTLETLVYEARCDVT
LTLKELQQMKDIEKLRLLMNSCSEDKYVTSAYQWMVPFLHRCEKQSPGVANELLKEYLVT
LAKGDLKFPLKIFQHSKPDLQQKIIPDQDQLMAIALECIYTCERNDQLCLCYDLLECLPE
RGYGDKTEATTKLHDMVDQLEQILSVSELLEKHGLEKPISFVKNTQSSSEEARKLMVRLT
RHTGRKQPPVSESHWRTLLQDMLTMQQNVYTCLDSDACYEIFTESLLCSSRLENIHLAGQ
MMHCSACSENPPAGIAHKGKPHYRVSYEKSIDLVLAASREYFNSSTNLTDSCMDLARCCL
QLITDRPPAIQEELDLIQAVGCLEEFGVKILPLQVRLCPDRISLIKECISQSPTCYKQST
KLLGLAELLRVAGENPEERRGQVLILLVEQALRFHDYKAASMHCQELMATGYPKSWDVCS
QLGQSEGYQDLATRQELMAFALTHCPPSSIELLLAASSSLQTEILYQRVNFQIHHEGGEN
ISASPLTSKAVQEDEVGVPGSNSADLLRWTTATTMKVLSNTTTTTKAVLQAVSDGQWWKK
SLTYLRPLQGQKCGGAYQIGTTANEDLEKQGCHPFYESVISNPFVAESEGTYDTYQHVPV
ESFAEVLLRTGKLAEAKNKGEVFPTTEVLLQLASEALPNDMTLALAYLLALPQVLDANRC
FEKQSPSALSLQLAAYYYSLQIYARLAPCFRDKCHPLYRADPKELIKMVTRHVTRHEHEA
WPEDLISLTKQLHCYNERLLDFTQAQILQGLRKGVDVQRFTADDQYKRETILGLAETLEE
SVYSIAISLAQRYSVSRWEVFMTHLEFLFTDSGLSTLEIENRAQDLHLFETLKTDPEAFH
QHMVKYIYPTIGGFDHERLQYYFTLLENCGCADLGNCAIKPETHIRLLKKFKVVASGLNY
KKLTDENMSPLEALEPVLSSQNILSISKLVPKIPEKDGQMLSPSSLYTIWLQKLFWTGDP
HLIKQVPGSSPEWLHAYDVCMKYFDRLHPGDLITVVDAVTFSPKAVTKLSVEARKEMTRK
AIKTVKHFIEKPRKRNSEDEAQEAKDSKVTYADTLNHLEKSLAHLETLSHSFILSLKNSE
QETLQKYSHLYDLSRSEKEKLHDEAVAICLDGQPLAMIQQLLEVAVGPLDISPKDIVQSA
IMKIISALSGGSADLGGPRDPLKVLEGVVAAVHASVDKGEELVSPEDLLEWLRPFCADDA
WPVRPRIHVLQILGQSFHLTEEDSKLLVFFRTEAILKASWPQRQVDIADIENEENRYCLF
MELLESSHHEAEFQHLVLLLQAWPPMKSEYVITNNPWVRLATVMLTRCTMENKEGLGNEV
LKMCRSLYNTKQMLPAEGVKELCLLLLNQSLLLPSLKLLLESRDEHLHEMALEQITAVTT
VNDSNCDQELLSLLLDAKLLVKCVSTPFYPRIVDHLLASLQQGRWDAEELGRHLREAGHE
AEAGSLLLAVRGTHQAFRTFSTALRAAQHWV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2RRP1	1.000	1.000	0.000	2371	1.000	1.000	A2RRP1.pdb.gz	NBAS_HUMAN NBAS subunit of NRZ tethering complex OS=Homo sapiens OX=9606 GN=NBAS PE=1 SV=2
2	AFDB:Q5TYW4	0.450	0.450	0.000	2372	0.641	0.640	Q5TYW4.pdb.gz	NBAS_DANRE NBAS subunit of NRZ tethering complex OS=Danio rerio OX=7955 GN=nbas PE=2 SV=1
3	AFDB:Q9FIN7	0.214	0.214	1.578E-67	2376	0.191	0.190	Q9FIN7.pdb.gz	MIP2_ARATH MAG2-interacting protein 2 OS=Arabidopsis thaliana OX=3702 GN=MIP2 PE=1 SV=1
4	AFDB:P90841	0.194	0.258	1.158E-48	1615	0.134	0.196	P90841.pdb.gz	P90841_CAEEL Neuroblastoma-amplified sequence OS=Caenorhabditis elegans OX=6239 GN=smgl-1 PE=1 SV=2
5	AFDB:P50748	0.184	0.194	1.127E-29	2209	0.142	0.153	P50748.pdb.gz	KNTC1_HUMAN Kinetochore-associated protein 1 OS=Homo sapiens OX=9606 GN=KNTC1 PE=1 SV=1
6	PDB:7qpgR	0.128	0.135	1.128E-27	2208	0.137	0.147	7qpgR.pdb.gz
7	AFDB:E7ES84	0.152	0.261	2.295E-18	1134	0.071	0.149	E7ES84.pdb.gz	E7ES84_HUMAN Kinetochore associated 1 OS=Homo sapiens OX=9606 GN=KNTC1 PE=1 SV=1
8	AFDB:P11442	0.113	0.135	1.934E-11	1675	0.100	0.142	P11442.pdb.gz	CLH1_RAT Clathrin heavy chain 1 OS=Rattus norvegicus OX=10116 GN=Cltc PE=1 SV=3
9	PDB:1xi4A	0.084	0.110	1.403E-10	1630	0.101	0.147	1xi4A.pdb.gz
10	AFDB:O14266	0.120	0.291	5.735E-9	769	0.050	0.155	O14266.pdb.gz	SEC39_SCHPO Protein transport protein sec39 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec39 PE=3 SV=1
11	PDB:7wooC	0.109	0.178	7.637E-9	1325	0.059	0.106	7wooC.pdb.gz
12	PDB:7mqaLQ	0.102	0.273	7.951E-9	830	0.022	0.063	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	AFDB:P40064	0.106	0.164	2.769E-8	1391	0.067	0.114	P40064.pdb.gz	NU157_YEAST Nucleoporin NUP157 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUP157 PE=1 SV=1
14	PDB:7mq8LO	0.093	0.219	3.267E-8	848	0.028	0.079	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:5lcwR	0.101	0.552	4.512E-8	383	0.023	0.144	5lcwR.pdb.gz	Molecular basis of APC/C regulation by the spindle assembly checkpoint.
16	PDB:7mq8LR	0.093	0.247	5.521E-8	773	0.028	0.087	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7r5jD4	0.102	0.169	5.985E-8	1312	0.065	0.118	7r5jD4.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
18	PDB:5yzgs	0.099	0.557	9.716E-8	374	0.023	0.144	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
19	PDB:6bk8M	0.096	0.595	1.012E-7	326	0.017	0.126	6bk8M.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
20	AFDB:H3BSH7	0.052	0.162	1.233E-7	700	0.027	0.093	H3BSH7.pdb.gz	H3BSH7_HUMAN UTP4 small subunit processome component (Fragment) OS=Homo sapiens OX=9606 GN=UTP4 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RRP1	0.0	4905	2371	1.000	1.000	NBAS_HUMAN NBAS subunit of NRZ tethering complex OS=Homo sapiens OX=9606 GN=NBAS PE=1 SV=2
2	Q5TYW4	0.0	3057	2372	0.640	0.640	NBAS_DANRE NBAS subunit of NRZ tethering complex OS=Danio rerio OX=7955 GN=nbas PE=2 SV=1
3	Q9FIN7	2.25e-64	246	2376	0.126	0.126	MIP2_ARATH MAG2-interacting protein 2 OS=Arabidopsis thaliana OX=3702 GN=MIP2 PE=1 SV=1
4	F4KH34	1.09e-42	175	2396	0.075	0.074	F4KH34_ARATH Neuroblastoma-amplified sequence protein OS=Arabidopsis thaliana OX=3702 GN=MIP2 PE=1 SV=1
5	P90841	2.18e-09	65.9	1615	0.024	0.035	P90841_CAEEL Neuroblastoma-amplified sequence OS=Caenorhabditis elegans OX=6239 GN=smgl-1 PE=1 SV=2
6	P06612	1.2	37.0	865	0.011	0.029	TOP1_ECOLI DNA topoisomerase 1 OS=Escherichia coli (strain K12) OX=83333 GN=topA PE=1 SV=2
7	Q582R9	2.5	35.8	596	0.011	0.045	Q582R9_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=AIP1 PE=4 SV=1
8	Q8NEP7	2.8	35.4	349	0.007	0.049	KLDC9_HUMAN Kelch domain-containing protein 9 OS=Homo sapiens OX=9606 GN=KLHDC9 PE=1 SV=2
9	Q96DN5	4.5	35.0	1066	0.008	0.018	TBC31_HUMAN TBC1 domain family member 31 OS=Homo sapiens OX=9606 GN=TBC1D31 PE=1 SV=2
10	Q2M1Z3	7.5	34.3	1444	0.014	0.024	RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens OX=9606 GN=ARHGAP31 PE=1 SV=2
11	O14266	7.6	34.3	769	0.014	0.043	SEC39_SCHPO Protein transport protein sec39 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec39 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	4.2e+02	12.6	Anaphase-promoting complex subunit 4 WD40 domain
2	PF15492 Nbas_N	1.2e-156	531.7	Neuroblastoma-amplified sequence, N terminal
3	PF04043 PMEI	28	16.5	Plant invertase/pectin methylesterase inhibitor
4	PF08314 Sec39	1e-26	105.3	Secretory pathway protein Sec39

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281513

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000257700	0.998	RAD50-interacting protein 1
2	9606.ENSP00000200135	0.995	Centromere/kinetochore protein zw10 homolog
3	9606.ENSP00000305810	0.994	Syntaxin-18
4	9606.ENSP00000263897	0.973	Vesicle transport protein USE1
5	9606.ENSP00000384182	0.913	Sec1 family domain-containing protein 2
6	9606.ENSP00000324628	0.904	Gamma-soluble NSF attachment protein
7	9606.ENSP00000463393	0.887	Vesicle-trafficking protein SEC22b
8	9606.ENSP00000331907	0.880	Probable ATP-dependent RNA helicase DHX34
9	9606.ENSP00000258301	0.845	Syntaxin-6
10	9606.ENSP00000231668	0.821	BCL2/adenovirus E1B 19kDa interacting protein 1
11	9606.ENSP00000329419	0.821	Coatomer subunit beta
12	9606.ENSP00000264028	0.802	Coatomer subunit delta
13	9606.ENSP00000325002	0.800	Coatomer subunit gamma-1
14	9606.ENSP00000249923	0.751	Coatomer subunit beta
15	9606.ENSP00000449270	0.746	Coatomer subunit zeta-1
16	9606.ENSP00000270066	0.743	Protein SMG9
17	9606.ENSP00000438748	0.719	Protein SMG8
18	9606.ENSP00000263073	0.718	Telomerase-binding protein EST1A
19	9606.ENSP00000348708	0.718	Regulator of nonsense transcripts 2
20	9606.ENSP00000387286	0.707	Ras-related protein Rab-1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000149	1.000	SNARE binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050789	0.986	regulation of biological process
GO:0006810	0.971	transport
GO:0050794	0.970	regulation of cellular process
GO:0016192	0.937	vesicle-mediated transport
GO:0008152	0.921	metabolic process
GO:0044237	0.896	cellular metabolic process
GO:0048193	0.889	Golgi vesicle transport
GO:0060255	0.878	regulation of macromolecule metabolic process
GO:0048519	0.871	negative regulation of biological process
GO:0048518	0.830	positive regulation of biological process
GO:0031323	0.830	regulation of cellular metabolic process
GO:0000956	0.829	nuclear-transcribed mRNA catabolic process
GO:0051171	0.828	regulation of nitrogen compound metabolic process
GO:0080090	0.814	regulation of primary metabolic process
GO:0010604	0.779	positive regulation of macromolecule metabolic process
GO:0048523	0.769	negative regulation of cellular process
GO:0031329	0.769	regulation of cellular catabolic process
GO:1902369	0.758	negative regulation of RNA catabolic process
GO:1903311	0.708	regulation of mRNA metabolic process
GO:0061013	0.625	regulation of mRNA catabolic process
GO:1903312	0.600	negative regulation of mRNA metabolic process
GO:1902373	0.586	negative regulation of mRNA catabolic process
GO:0006890	0.396	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0016020	1.000	membrane
GO:0005829	1.000	cytosol
GO:0005783	0.999	endoplasmic reticulum
GO:0099023	0.994	vesicle tethering complex
GO:0140534	0.987	endoplasmic reticulum protein-containing complex
GO:0031090	0.863	organelle membrane
GO:0031982	0.843	vesicle
GO:0070939	0.759	Dsl1/NZR complex
GO:0005634	0.708	nucleus
GO:0043232	0.534	intracellular non-membrane-bounded organelle
GO:0031410	0.514	cytoplasmic vesicle
GO:0071944	0.438	cell periphery
GO:0031984	0.437	organelle subcompartment
GO:0070013	0.370	intracellular organelle lumen
GO:0031981	0.329	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]