StarFunc result for job id A2RU30

User Input

>input (521 residues)
MEASVLSPTSWEKRRAWLRQSRNWQTQVLEEEAAAALQDVPDPEPSSLDDVFQEGNPINK
IEDWLQDCGYSEEGFSEEAGQFIYNGFCSHGTSFEDDLTLGAEATLLAANGKLFSRSFLE
TARPCQLLDLGCSLASSSMTGGTNKTSSSISEILDKVQEDAEDVLFSLGFGQEDHKDTSR
IPARFFTTPSQAKGIDFQLFLKSQVRRIEMEDPCLMLASRFKQVQTLAVTADAFFCLYSY
VSKTPVQKFTPSHMFWNCNHPTDVPSIRILSREPEPQSPRDRLRKAISKMCLYTCPRDRP
PPPHNTPKRNSLDQVVLEVMDKVKEEKQFLQQDSDLGQFSQEDPVPPAEGKKLPTSPYPC
VFCCEEETQQRMSTVLAPSQTLDSNPKVPCCTHSLPIEDPQWSTDPAQIRRELCSLPATN
TETHPAKDETFWKRKSRARKSLFQKNLMGRKVKSLDLSITQQKWKQSVDRPELRRSLSQQ
PQDTFDLEEVQSNSEEEQSQSRWPSRPRHPHHHQTFAGKDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RB73	0.151	0.151	4.665E-70	521	1.000	1.000	A0A024RB73.pdb.gz
2	AFDB:Q3U132	0.360	0.393	1.825E-46	458	0.622	0.707	Q3U132.pdb.gz	TESP1_MOUSE Protein TESPA1 OS=Mus musculus OX=10090 GN=Tespa1 PE=1 SV=1
3	AFDB:P28290	0.145	0.077	8.251E-13	1259	0.253	0.105	P28290.pdb.gz	ITPI2_HUMAN Protein ITPRID2 OS=Homo sapiens OX=9606 GN=ITPRID2 PE=1 SV=3
4	AFDB:E9PHV5	0.145	0.071	5.413E-11	1237	0.251	0.106	E9PHV5.pdb.gz	E9PHV5_HUMAN ITPR interacting domain containing 2 OS=Homo sapiens OX=9606 GN=ITPRID2 PE=1 SV=1
5	AFDB:E7EZE5	0.076	0.039	1.216E-3	1252	0.142	0.059	E7EZE5.pdb.gz	E7EZE5_DANRE IQ motif and SEC7 domain-containing protein 1 isoform X1 OS=Danio rerio OX=7955 GN=iqsec1b PE=1 SV=1
6	AFDB:A1Z6W3	0.066	0.035	3.875E-3	1299	0.140	0.056	A1Z6W3.pdb.gz	PRIC1_DROME Protein prickle OS=Drosophila melanogaster OX=7227 GN=pk PE=1 SV=1
7	AFDB:Q8ND83	0.073	0.068	4.132E-3	568	0.157	0.144	Q8ND83.pdb.gz	SLAI1_HUMAN SLAIN motif-containing protein 1 OS=Homo sapiens OX=9606 GN=SLAIN1 PE=1 SV=3
8	AFDB:A0A1D8PSN1	0.083	0.064	4.700E-3	750	0.132	0.092	A0A1D8PSN1.pdb.gz	A0A1D8PSN1_CANAL Transcription initiation factor TFIID subunit 12 domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TAF12L PE=3 SV=1
9	AFDB:Q382N7	0.059	0.066	7.865E-3	444	0.121	0.142	Q382N7.pdb.gz	Q382N7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.52.0016 PE=4 SV=1
10	AFDB:Q8K0L9	0.084	0.064	1.404E-2	741	0.134	0.094	Q8K0L9.pdb.gz	ZBT20_MOUSE Zinc finger and BTB domain-containing protein 20 OS=Mus musculus OX=10090 GN=Zbtb20 PE=1 SV=1
11	PDB:5gm6c	0.085	0.102	1.335	415	0.046	0.058	5gm6c.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
12	PDB:7enal	0.047	0.164	4.252	126	0.027	0.111	7enal.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
13	PDB:6n8jb	0.066	0.057	5.867	647	0.086	0.070	6n8jb.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
14	PDB:7pntL	0.052	0.137	8.094	176	0.017	0.051	7pntL.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
15	PDB:7d5sRN	0.068	0.060	9.206	607	0.040	0.035	7d5sRN.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
16	PDB:4v88Ah	0.066	0.154	9.818	159	0.040	0.132	4v88Ah.pdb.gz	The structure of the eukaryotic ribosome at 3.0 angstrom resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RU30	0.0	1075	521	1.000	1.000	TESP1_HUMAN Protein TESPA1 OS=Homo sapiens OX=9606 GN=TESPA1 PE=1 SV=2
2	Q3U132	0.0	605	458	0.628	0.714	TESP1_MOUSE Protein TESPA1 OS=Mus musculus OX=10090 GN=Tespa1 PE=1 SV=1
3	E9PPW8	1.43e-49	167	100	0.155	0.810	E9PPW8_HUMAN Thymocyte expressed, positive selection associated 1 (Fragment) OS=Homo sapiens OX=9606 GN=TESPA1 PE=1 SV=1
4	E9PM24	1.45e-49	166	80	0.154	1.000	E9PM24_HUMAN Thymocyte expressed, positive selection associated 1 (Fragment) OS=Homo sapiens OX=9606 GN=TESPA1 PE=1 SV=1
5	E9PHV5	2.46e-37	149	1237	0.198	0.083	E9PHV5_HUMAN ITPR interacting domain containing 2 OS=Homo sapiens OX=9606 GN=ITPRID2 PE=1 SV=1
6	P28290	2.58e-37	149	1259	0.198	0.082	ITPI2_HUMAN Protein ITPRID2 OS=Homo sapiens OX=9606 GN=ITPRID2 PE=1 SV=3
7	Q4TT88	2.9	33.1	948	0.058	0.032	PSA_CAEEL Puromycin-sensitive aminopeptidase OS=Caenorhabditis elegans OX=6239 GN=pam-1 PE=1 SV=1
8	P25386	4.3	32.7	1790	0.054	0.016	USO1_YEAST Intracellular protein transport protein USO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=USO1 PE=1 SV=2
9	F8SUI8	4.9	32.0	253	0.027	0.055	F8SUI8_9BACT Feruloyl esterase (Fragment) OS=uncultured bacterium OX=77133 PE=4 SV=1
10	Q8IY82	5.6	32.3	874	0.058	0.034	DRC7_HUMAN Dynein regulatory complex subunit 7 OS=Homo sapiens OX=9606 GN=DRC7 PE=1 SV=3
11	Q70MW9	8.6	30.4	160	0.050	0.163	Q70MW9_TRYBR Serum resistance associated protein (Fragment) OS=Trypanosoma brucei rhodesiense OX=31286 GN=SRA PE=4 SV=1
12	P60330	9.6	31.6	2118	0.029	0.007	ESPL1_MOUSE Separin OS=Mus musculus OX=10090 GN=Espl1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11159 DUF2939	6e+02	12.2	Protein of unknown function (DUF2939)
2	PF14722 KRAP_IP3R_bind	2.4e-47	171.8	Ki-ras-induced actin-interacting protein-IP3R-interacting domain
3	PF09409 PUB	58	15.0	PUB domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000400892

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000244007	0.977	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
2	9606.ENSP00000376345	0.940	Growth factor receptor-bound protein 2
3	9606.ENSP00000264389	0.900	COP9 signalosome complex subunit 4
4	9606.ENSP00000268717	0.900	COP9 signalosome complex subunit 3
5	9606.ENSP00000299259	0.900	COP9 signalosome complex subunit 2
6	9606.ENSP00000304102	0.900	COP9 signalosome complex subunit 6
7	9606.ENSP00000304147	0.900	Myeloma overexpressed 2
8	9606.ENSP00000346340	0.900	COP9 signalosome complex subunit 8
9	9606.ENSP00000350512	0.900	COP9 signalosome complex subunit 5
10	9606.ENSP00000362710	0.900	COP9 signalosome complex subunit 7b
11	9606.ENSP00000376167	0.900	COP9 signalosome complex subunit 1
12	9606.ENSP00000438115	0.900	COP9 signalosome complex subunit 7a
13	9606.ENSP00000297185	0.898	Stress-70 protein, mitochondrial
14	9606.ENSP00000357231	0.871	Protein THEMIS
15	9606.ENSP00000306253	0.852	Inositol 1,4,5-trisphosphate receptor type 1
16	9606.ENSP00000378845	0.796	Linker for activation of T cells
17	9606.ENSP00000451406	0.681	17-beta-hydroxysteroid dehydrogenase type 6
18	9606.ENSP00000257895	0.674	11-cis retinol dehydrogenase
19	9606.ENSP00000388731	0.673	Sperm specific antigen 2
20	9606.ENSP00000427567	0.673	Microtubule-associated formin which regulates both actin and microtubule dynamics. Induces microtubule acetylation and stabilization and actin stress fiber formation . Regulates Golgi ribbon formation . Required for normal cilia assembly. Early in cilia assembly, may assist in the maturation and positioning of the centrosome/basal body, and once cilia assembly has initiated, may also promote cilia elongation by inhibiting disassembly

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043274	1.000	phospholipase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0009987	0.984	cellular process
GO:0051239	0.921	regulation of multicellular organismal process
GO:0048518	0.882	positive regulation of biological process
GO:0048583	0.873	regulation of response to stimulus
GO:0032501	0.869	multicellular organismal process
GO:0002682	0.867	regulation of immune system process
GO:0048522	0.862	positive regulation of cellular process
GO:0050793	0.828	regulation of developmental process
GO:0045595	0.813	regulation of cell differentiation
GO:0032502	0.763	developmental process
GO:0002376	0.762	immune system process
GO:0051249	0.738	regulation of lymphocyte activation
GO:0002684	0.736	positive regulation of immune system process
GO:0050863	0.734	regulation of T cell activation
GO:0022407	0.729	regulation of cell-cell adhesion
GO:0060284	0.717	regulation of cell development
GO:0048856	0.708	anatomical structure development
GO:0051251	0.707	positive regulation of lymphocyte activation
GO:1903037	0.704	regulation of leukocyte cell-cell adhesion
GO:0022409	0.675	positive regulation of cell-cell adhesion
GO:0048468	0.650	cell development
GO:0050870	0.643	positive regulation of T cell activation
GO:0071840	0.625	cellular component organization or biogenesis
GO:0045597	0.601	positive regulation of cell differentiation
GO:0030097	0.590	hemopoiesis
GO:0046649	0.582	lymphocyte activation
GO:1903131	0.514	mononuclear cell differentiation
GO:0010720	0.507	positive regulation of cell development
GO:0030098	0.504	lymphocyte differentiation
GO:0009966	0.427	regulation of signal transduction
GO:2000026	0.390	regulation of multicellular organismal development
GO:0016043	0.384	cellular component organization
GO:1903706	0.339	regulation of hemopoiesis
GO:0048519	0.303	negative regulation of biological process
GO:1902105	0.300	regulation of leukocyte differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0032991	0.933	protein-containing complex
GO:0043231	0.905	intracellular membrane-bounded organelle
GO:0005634	0.887	nucleus
GO:0070013	0.513	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]