StarFunc result for job id A2RU49

User Input

>input (373 residues)
MSSGNYQQSEALSKPTFSEEQASALVESVFGLKVSKVRPLPSYDDQNFHVYVSKTKDGPT
EYVLKISNTKASKNPDLIEVQNHIIMFLKAAGFPTASVCHTKGDNTASLVSVDSGSEIKS
YLVRLLTYLPGRPIAELPVSPQLLYEIGKLAAKLDKTLQRFHHPKLSSLHRENFIWNLKN
VPLLEKYLYALGQNRNREIVEHVIHLFKEEVMTKLSHFRECINHGDLNDHNILIESSKSA
SGNAEYQVSGILDFGDMSYGYYVFEVAITIMYMMIESKSPIQVGGHVLAGFESITPLTAV
EKGALFLLVCSRFCQSLVMAAYSCQLYPENKDYLMVTAKTGWKHLQQMFDMGQKAVEEIW
FETAKSYESGISM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2RU49	1.000	1.000	1.277E-62	373	1.000	1.000	A2RU49.pdb.gz	HYKK_HUMAN Hydroxylysine kinase OS=Homo sapiens OX=9606 GN=HYKK PE=1 SV=2
2	AFDB:E8MF12	0.681	0.705	1.838E-12	359	0.177	0.184	E8MF12.pdb.gz	NAHK_BIFL2 N-acetylhexosamine 1-kinase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=nahK PE=1 SV=1
3	PDB:4wh3A	0.618	0.642	7.279E-12	356	0.180	0.188	4wh3A.pdb.gz	Open-close structural change upon ligand binding and two magnesium ions required for the catalysis of N-acetylhexosamine 1-kinase
4	AFDB:P29364	0.602	0.698	1.082E-11	316	0.145	0.171	P29364.pdb.gz	KHSE_PSEAE Homoserine kinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=thrB PE=3 SV=2
5	AFDB:P0C0K3	0.605	0.675	2.244E-10	328	0.137	0.155	P0C0K3.pdb.gz	SRKA_ECOLI Stress response kinase A OS=Escherichia coli (strain K12) OX=83333 GN=srkA PE=1 SV=1
6	AFDB:Q9Y259	0.536	0.512	5.108E-9	395	0.142	0.134	Q9Y259.pdb.gz	CHKB_HUMAN Choline/ethanolamine kinase OS=Homo sapiens OX=9606 GN=CHKB PE=1 SV=3
7	PDB:4da5A	0.514	0.537	7.248E-9	352	0.121	0.128	4da5A.pdb.gz	Kinetic and mechanistic characterisation of Choline Kinase-alpha.
8	AFDB:O54804	0.526	0.450	1.298E-8	453	0.129	0.106	O54804.pdb.gz	CHKA_MOUSE Choline kinase alpha OS=Mus musculus OX=10090 GN=Chka PE=1 SV=3
9	PDB:1zylA	0.566	0.636	1.758E-8	325	0.142	0.163	1zylA.pdb.gz
10	AFDB:Q9NVF9	0.552	0.536	2.169E-8	386	0.134	0.130	Q9NVF9.pdb.gz	EKI2_HUMAN Ethanolamine kinase 2 OS=Homo sapiens OX=9606 GN=ETNK2 PE=1 SV=3
11	AFDB:Q8IMT6	0.432	0.398	2.495E-8	422	0.137	0.121	Q8IMT6.pdb.gz	Q8IMT6_DROME FI01822p OS=Drosophila melanogaster OX=7227 GN=CG13657 PE=2 SV=1
12	PDB:1nw1A	0.480	0.488	3.224E-8	365	0.153	0.156	1nw1A.pdb.gz	The Crystal Structure of Choline Kinase Reveals a Eukaryotic Protein Kinase Fold
13	PDB:2ig7B	0.497	0.533	3.224E-8	342	0.150	0.164	2ig7B.pdb.gz
14	AFDB:Q9VBT3	0.415	0.379	3.300E-8	422	0.145	0.128	Q9VBT3.pdb.gz	Q9VBT3_DROME CHK kinase-like domain-containing protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG13658 PE=4 SV=3
15	AFDB:Q9VBT4	0.456	0.417	3.796E-8	420	0.142	0.126	Q9VBT4.pdb.gz	Q9VBT4_DROME IP12282p OS=Drosophila melanogaster OX=7227 GN=CG13657 PE=2 SV=2
16	PDB:4ww9A	0.326	0.476	6.464E-5	238	0.113	0.176	4ww9A.pdb.gz	Crystal structures of the Gon7/Pcc1 and Bud32/Cgi121 complexes provide a model for the complete yeast KEOPS complex.
17	PDB:2pywA	0.494	0.453	6.772E-5	417	0.131	0.118	2pywA.pdb.gz	Structure of A. thaliana 5-methylthioribose kinase in complex with ADP and MTR reveals a more occluded active site than its bacterial homolog
18	PDB:6oidA	0.402	0.494	2.386E-4	289	0.107	0.138	6oidA.pdb.gz	A redox-active switch in fructosamine-3-kinases expands the regulatory repertoire of the protein kinase superfamily.
19	PDB:4o7pB	0.404	0.347	3.157E-4	451	0.126	0.104	4o7pB.pdb.gz	Homotypic dimerization of a maltose kinase for molecular scaffolding.
20	PDB:6tcaA	0.261	0.279	6.355E-4	345	0.118	0.128	6tcaA.pdb.gz	MAP Kinase-Mediated Activation of RSK1 and MK2 Substrate Kinases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RU49	0.0	777	373	1.000	1.000	HYKK_HUMAN Hydroxylysine kinase OS=Homo sapiens OX=9606 GN=HYKK PE=1 SV=2
2	A0A0C4DGM4	2.05e-163	458	226	0.592	0.978	A0A0C4DGM4_HUMAN Hydroxylysine kinase OS=Homo sapiens OX=9606 GN=HYKK PE=1 SV=1
3	A0A2R8YGD3	0.64	34.7	1679	0.075	0.017	A0A2R8YGD3_HUMAN Rap guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1
4	F1MSG6	0.66	34.7	1486	0.078	0.020	RPGF2_BOVIN Rap guanine nucleotide exchange factor 2 OS=Bos taurus OX=9913 GN=RAPGEF2 PE=1 SV=2
5	Q17RH5	0.66	34.7	1486	0.075	0.019	Q17RH5_HUMAN RAPGEF2 protein OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1
6	A0A2R8Y661	0.70	34.7	1559	0.075	0.018	A0A2R8Y661_HUMAN Rap guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1
7	F1PBJ0	0.70	34.7	1498	0.075	0.019	RPGF2_CANLF Rap guanine nucleotide exchange factor 2 OS=Canis lupus familiaris OX=9615 GN=RAPGEF2 PE=1 SV=2
8	Q9Y4G8	0.70	34.7	1499	0.075	0.019	RPGF2_HUMAN Rap guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1
9	F4JFM6	1.8	33.1	555	0.083	0.056	F4JFM6_ARATH Transcriptional adapter OS=Arabidopsis thaliana OX=3702 GN=ADA2A PE=1 SV=1
10	Q9SFD5	1.8	33.1	548	0.083	0.057	TAD2A_ARATH Transcriptional adapter ADA2a OS=Arabidopsis thaliana OX=3702 GN=ADA2A PE=1 SV=1
11	Q8CHG7	4.4	32.0	1496	0.072	0.018	RPGF2_MOUSE Rap guanine nucleotide exchange factor 2 OS=Mus musculus OX=10090 GN=Rapgef2 PE=1 SV=2
12	F1M386	4.6	32.0	1496	0.072	0.018	RPGF2_RAT Rap guanine nucleotide exchange factor 2 OS=Rattus norvegicus OX=10116 GN=Rapgef2 PE=1 SV=2
13	Q57YZ3	6.6	31.6	1405	0.070	0.019	Q57YZ3_TRYB2 Rapamycin-insensitive companion of TOR2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28L1.170 PE=1 SV=1
14	Q8BFR4	9.1	30.8	544	0.070	0.048	GNS_MOUSE N-acetylglucosamine-6-sulfatase OS=Mus musculus OX=10090 GN=Gns PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	3.5e-24	97.5	Phosphotransferase enzyme family
2	PF02958 EcKL	1.6e+02	13.0	Ecdysteroid kinase-like family
3	PF19974 TCAD9	57	14.2	Ternary complex associated domain 9

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000455459

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310978	0.996	5-phosphohydroxy-L-lysine phospho-lyase
2	9606.ENSP00000296486	0.936	Ethanolamine-phosphate phospho-lyase
3	9606.ENSP00000315602	0.801	Neuronal acetylcholine receptor subunit alpha-3
4	9606.ENSP00000299565	0.738	Neuronal acetylcholine receptor subunit alpha-5
5	9606.ENSP00000231420	0.711	Alanine--glyoxylate aminotransferase 2, mitochondrial
6	9606.ENSP00000261751	0.706	Neuronal acetylcholine receptor subunit beta-4
7	9606.ENSP00000044462	0.683	Proteasome subunit alpha type-4
8	9606.ENSP00000258886	0.635	Iron-responsive element-binding protein 2
9	9606.ENSP00000369456	0.596	Inosine triphosphate pyrophosphatase
10	9606.ENSP00000313854	0.566	Cleft lip and palate transmembrane protein 1-like protein
11	9606.ENSP00000251170	0.502	SEC14-like protein 5
12	9606.ENSP00000264344	0.501	Protein FAM13A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016773	1.000	phosphotransferase activity, alcohol group as acceptor
GO:0019202	1.000	amino acid kinase activity
GO:0005488	0.943	binding
GO:0005515	0.931	protein binding
GO:0047992	0.900	hydroxylysine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.970	organic substance metabolic process
GO:0019752	0.956	carboxylic acid metabolic process
GO:0046395	0.927	carboxylic acid catabolic process
GO:0009063	0.922	amino acid catabolic process
GO:1901606	0.922	alpha-amino acid catabolic process
GO:0009066	0.905	aspartate family amino acid metabolic process
GO:0009068	0.899	aspartate family amino acid catabolic process
GO:0006553	0.775	lysine metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005759	0.999	mitochondrial matrix
GO:0005634	0.790	nucleus
GO:0031981	0.586	nuclear lumen
GO:0005654	0.572	nucleoplasm
GO:0005829	0.430	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
RHEA:19049	0.900	(5R)-5-hydroxy-L-lysine + GTP = (5R)-5-phosphooxy-L-lysine + GDP + H(+)
EC:2.7.1.81	0.900	hydroxylysine kinase.

[back to server]