StarFunc result for job id A2RU54

User Input

>input (273 residues)
MGSKEDAGKGCPAAGGVSSFTIQSILGGGPSEAPREPVGWPARKRSLSVSSEEEEPDDGW
KAPACFCPDQHGPKEQGPKHHPPIPFPCLGTPKGSGGSGPGGLERTPFLSPSHSDFKEEK
ERLLPAGSPSPGSERPRDGGAERQAGAAKKKTRTVFSRSQVYQLESTFDMKRYLSSSERA
CLASSLQLTETQVKTWFQNRRNKWKRQLSAELEAANMAHASAQTLVSMPLVFRDSSLLRV
PVPRSLAFPAPLYYPGSNLSALPLYNLYNKLDY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2RU54	1.000	1.000	1.159E-39	273	1.000	1.000	A2RU54.pdb.gz	HMX2_HUMAN Homeobox protein HMX2 OS=Homo sapiens OX=9606 GN=HMX2 PE=2 SV=1
2	AFDB:F1QTJ6	0.368	0.373	1.540E-24	269	0.641	0.651	F1QTJ6.pdb.gz	F1QTJ6_DANRE H6 family homeobox 2 OS=Danio rerio OX=7955 GN=hmx2 PE=4 SV=1
3	AFDB:A0A2R8Q2A2	0.288	0.279	3.869E-13	282	0.355	0.344	A0A2R8Q2A2.pdb.gz
4	AFDB:Q9NP08	0.280	0.222	8.636E-11	348	0.370	0.290	Q9NP08.pdb.gz	HMX1_HUMAN Homeobox protein HMX1 OS=Homo sapiens OX=9606 GN=HMX1 PE=2 SV=2
5	AFDB:Q18533	0.260	0.210	1.053E-10	341	0.271	0.217	Q18533.pdb.gz	HMX_CAEEL Homeobox protein mls-2 OS=Caenorhabditis elegans OX=6239 GN=mls-2 PE=1 SV=2
6	AFDB:Q6ZNG2	0.267	0.218	2.665E-9	339	0.249	0.201	Q6ZNG2.pdb.gz	DBX2_HUMAN Homeobox protein DBX2 OS=Homo sapiens OX=9606 GN=DBX2 PE=2 SV=2
7	AFDB:P42580	0.292	0.265	4.517E-9	305	0.282	0.252	P42580.pdb.gz	NKX12_MOUSE NK1 transcription factor-related protein 2 OS=Mus musculus OX=10090 GN=Nkx1-2 PE=1 SV=1
8	AFDB:Q28ET4	0.286	0.297	7.168E-9	262	0.264	0.275	Q28ET4.pdb.gz	VENT1_XENTR Homeobox protein vent1 OS=Xenopus tropicalis OX=8364 GN=vent1 PE=2 SV=1
9	AFDB:P78367	0.275	0.229	1.298E-8	333	0.319	0.261	P78367.pdb.gz	NKX32_HUMAN Homeobox protein Nkx-3.2 OS=Homo sapiens OX=9606 GN=NKX3-2 PE=1 SV=2
10	AFDB:P97436	0.281	0.319	5.184E-8	237	0.216	0.249	P97436.pdb.gz	NKX31_MOUSE Homeobox protein Nkx-3.1 OS=Mus musculus OX=10090 GN=Nkx3-1 PE=1 SV=1
11	PDB:4egcA	0.176	0.091	1.035E-2	539	0.070	0.035	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.185	0.614	2.782E-2	73	0.059	0.219	2hi3A.pdb.gz
13	PDB:5aj0BZ	0.151	0.415	8.040E-1	86	0.026	0.081	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
14	PDB:7fbyA	0.138	0.231	1.047	153	0.029	0.052	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
15	PDB:5nr5A	0.141	0.313	1.661	113	0.037	0.088	5nr5A.pdb.gz
16	PDB:7dcoL	0.136	0.089	1.774	435	0.062	0.039	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
17	PDB:7b93E	0.101	0.125	2.815	215	0.033	0.042	7b93E.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
18	PDB:7awtE	0.123	0.205	3.212	156	0.015	0.026	7awtE.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.
19	PDB:2cg4A	0.148	0.257	3.914	149	0.011	0.020	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
20	PDB:2ffhA	0.126	0.086	3.914	407	0.029	0.020	2ffhA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RU54	0.0	555	273	1.000	1.000	HMX2_HUMAN Homeobox protein HMX2 OS=Homo sapiens OX=9606 GN=HMX2 PE=2 SV=1
2	P43687	5.71e-179	495	273	0.938	0.938	HMX2_MOUSE Homeobox protein HMX2 OS=Mus musculus OX=10090 GN=Hmx2 PE=2 SV=3
3	F1QTJ6	6.38e-104	305	269	0.652	0.662	F1QTJ6_DANRE H6 family homeobox 2 OS=Danio rerio OX=7955 GN=hmx2 PE=4 SV=1
4	P42581	1.94e-47	163	356	0.322	0.247	HMX3_MOUSE Homeobox protein HMX3 OS=Mus musculus OX=10090 GN=Hmx3 PE=1 SV=3
5	Q504H8	1.64e-46	159	297	0.304	0.279	HMX3_DANRE Homeobox protein HMX3 OS=Danio rerio OX=7955 GN=hmx3 PE=2 SV=1
6	Q9DE09	3.12e-39	141	333	0.249	0.204	HMX1_CHICK Homeobox protein HMX1 OS=Gallus gallus OX=9031 GN=HMX1 PE=2 SV=1
7	A9Y2A9	6.04e-39	139	282	0.275	0.266	A9Y2A9_DANRE Homeobox protein HMX1 OS=Danio rerio OX=7955 GN=Nkx5-3 PE=2 SV=1
8	O70218	2.22e-38	139	332	0.242	0.199	HMX1_MOUSE Homeobox protein HMX1 OS=Mus musculus OX=10090 GN=Hmx1 PE=2 SV=1
9	Q9NP08	1.61e-36	134	348	0.231	0.181	HMX1_HUMAN Homeobox protein HMX1 OS=Homo sapiens OX=9606 GN=HMX1 PE=2 SV=2
10	Q0P3T9	4.14e-36	128	152	0.234	0.421	Q0P3T9_DANRE H6 family homeobox 4 OS=Danio rerio OX=7955 GN=hmx4 PE=2 SV=1
11	B7ZD71	9.49e-36	129	238	0.234	0.269	B7ZD71_DANRE H6 family homeobox 4 OS=Danio rerio OX=7955 GN=Hmx1 PE=4 SV=1
12	Q18533	9.89e-24	100	341	0.190	0.152	HMX_CAEEL Homeobox protein mls-2 OS=Caenorhabditis elegans OX=6239 GN=mls-2 PE=1 SV=2
13	Q803Z6	3.38e-20	89.0	245	0.223	0.249	Q803Z6_DANRE Bagpipe homeobox transcription factor Bapx1 OS=Danio rerio OX=7955 GN=nkx3.2 PE=2 SV=1
14	Q61663	6.29e-20	89.0	284	0.179	0.173	TLX2_MOUSE T-cell leukemia homeobox protein 2 OS=Mus musculus OX=10090 GN=Tlx2 PE=2 SV=1
15	A6NCS4	6.65e-20	89.4	301	0.194	0.176	NKX26_HUMAN Homeobox protein Nkx-2.6 OS=Homo sapiens OX=9606 GN=NKX2-6 PE=1 SV=1
16	O43763	1.04e-19	88.2	284	0.187	0.180	TLX2_HUMAN T-cell leukemia homeobox protein 2 OS=Homo sapiens OX=9606 GN=TLX2 PE=1 SV=2
17	P97503	4.61e-19	87.4	333	0.190	0.156	NKX32_MOUSE Homeobox protein Nkx-3.2 OS=Mus musculus OX=10090 GN=Nkx3-2 PE=1 SV=2
18	O55144	5.04e-19	86.7	291	0.165	0.155	TLX3_MOUSE T-cell leukemia homeobox protein 3 OS=Mus musculus OX=10090 GN=Tlx3 PE=2 SV=2
19	O43711	5.30e-19	86.7	291	0.165	0.155	TLX3_HUMAN T-cell leukemia homeobox protein 3 OS=Homo sapiens OX=9606 GN=TLX3 PE=1 SV=3
20	P78367	8.54e-19	86.7	333	0.190	0.156	NKX32_HUMAN Homeobox protein Nkx-3.2 OS=Homo sapiens OX=9606 GN=NKX3-2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	3.8e+02	12.4	Homeobox KN domain
2	PF00046 Homeodomain	5.4e-17	72.7	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000341108

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000320171	0.797	Pyruvate kinase PKM
2	9606.ENSP00000466799	0.610	Estradiol 17-beta-dehydrogenase 1
3	9606.ENSP00000379880	0.592	Leucine-rich repeat-containing protein 3B
4	9606.ENSP00000252505	0.590	Probable allantoicase
5	9606.ENSP00000359575	0.589	LIM domain transcription factor LMO4
6	9606.ENSP00000482704	0.546	Dehydrogenase/reductase SDR family member 11
7	9606.ENSP00000362981	0.539	Homeobox protein TGIF2
8	9606.ENSP00000440167	0.516	Ras-related protein Rab-19
9	9606.ENSP00000388510	0.507	Retinoic acid receptor gamma
10	9606.ENSP00000265643	0.502	Galanin peptides

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.965	protein binding
GO:0003700	0.926	DNA-binding transcription factor activity
GO:0000976	0.712	transcription cis-regulatory region binding
GO:0000981	0.569	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0009987	0.981	cellular process
GO:0007275	0.961	multicellular organism development
GO:0019222	0.899	regulation of metabolic process
GO:0031323	0.892	regulation of cellular metabolic process
GO:0080090	0.875	regulation of primary metabolic process
GO:0048513	0.829	animal organ development
GO:0060255	0.806	regulation of macromolecule metabolic process
GO:0051171	0.769	regulation of nitrogen compound metabolic process
GO:0009889	0.750	regulation of biosynthetic process
GO:0010468	0.748	regulation of gene expression
GO:0051252	0.739	regulation of RNA metabolic process
GO:0031326	0.716	regulation of cellular biosynthetic process
GO:0010556	0.715	regulation of macromolecule biosynthetic process
GO:0006355	0.712	regulation of DNA-templated transcription
GO:0048731	0.652	system development
GO:0048518	0.576	positive regulation of biological process
GO:0048522	0.552	positive regulation of cellular process
GO:0006357	0.548	regulation of transcription by RNA polymerase II
GO:0009893	0.528	positive regulation of metabolic process
GO:0009653	0.518	anatomical structure morphogenesis
GO:0051173	0.512	positive regulation of nitrogen compound metabolic process
GO:0010604	0.512	positive regulation of macromolecule metabolic process
GO:0050896	0.466	response to stimulus
GO:0051254	0.460	positive regulation of RNA metabolic process
GO:0045893	0.406	positive regulation of DNA-templated transcription
GO:0045944	0.392	positive regulation of transcription by RNA polymerase II
GO:0048519	0.339	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.975	nuclear lumen
GO:0005654	0.943	nucleoplasm
GO:0005737	0.412	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]