StarFunc result for job id A2RUB1

User Input

>input (952 residues)
MEVRRGDTCPRPHPSGLREEGLEPKVAFPGGANRCWNLGADAGSRLTDVFGSVMLTGSAS
FYDCYTSQSEDNVDLRQTYTPFSSTEYSSSVDSSLFCAPWSTYGDDIKQPSNSQISIKNR
IQTERNDYGSETDLYGLVSNILEEQDKSQPYFAEGTCSSNLKSVWPMNTSRFADHHDLLT
ETKRPIDTVISQQAFYSDESVSAMEKQYLRNSNLTPQQKIDELHHGFTGLDLEEQWMYPS
RSDHSNCHNIQTNDTAKTTFQEYPLIKNCFTPQTGLSDIMKESGVDIYHYGRDRICTKGL
EAPLQQKRAEMFLSQFNRYNENVDYCRYPEYVHPNKAKLNKCSNFSVQDSKKLANGTPET
PTVEADTYTKLFQVKPANQKKMEETIPDQQNFTFPKTTPHLTEKQFAKEAVFTADFGLTS
EYGLKPHTACPANDFANVTEKQQFAKPDPPHSEYFKSVNLLSNSATSSGGINLNRPTWMN
VQTKNNTPIPYRNQGNLMKLNSHLSAASKGSNHSSDFPQLSSTNLTPNSNLFQKYCQENP
SAFSSFDFSYSGAERIQSVNHIEGLTKPGEENLFKLVTDKKIKQPNGFCDNYSAQKYGII
ENVNKHNFQAKPQSGHYDPEEGPKHLDGLSQNTYQDLLESQGHSNSHRTRGGDNSRVNRT
QVSCFSNNYMMGDLRHNQCFQQLGSNGFPLRSTHPFGHSVVPLLDSYDLLSYDDLSHLYP
YFNMMYGDNSFSGLMPTFGFQRPIKTRSGPASELHIRLEECCEQWRALEKERKKTELALA
KNYPGKKVSSTNNTPVPRLTSNPSRVDRLIVDELRELARVVTLLGKMERLRSSLLHASIS
TALDRHLESIHIVQSRRKDEIVNASNRQRQGVPRCQDDRDVFALASAIKEMCVATRKTRT
ALWCALQMTLPKTASTADVVKPLQDTVNCEDKVHESINSSNPMNQRGETNKH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AG06	0.298	0.295	9.207E-81	965	0.884	0.873	A2AG06.pdb.gz	MEIOC_MOUSE Meiosis-specific coiled-coil domain-containing protein MEIOC OS=Mus musculus OX=10090 GN=Meioc PE=1 SV=1
2	AFDB:Q5SYB0	0.076	0.051	1.816E-2	1578	0.143	0.086	Q5SYB0.pdb.gz	FRPD1_HUMAN FERM and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FRMPD1 PE=1 SV=1
3	AFDB:D3ZW88	0.077	0.057	1.225E-1	1371	0.146	0.101	D3ZW88.pdb.gz	D3ZW88_RAT FERM and PDZ domain containing 1 OS=Rattus norvegicus OX=10116 GN=Frmpd1 PE=4 SV=3
4	AFDB:F4IZK5	0.065	0.053	1.283E-1	1403	0.147	0.100	F4IZK5.pdb.gz	F4IZK5_ARATH CW-type Zinc Finger OS=Arabidopsis thaliana OX=3702 GN=At3g62900 PE=1 SV=2
5	AFDB:B1AZP2	0.072	0.069	1.697E-1	992	0.153	0.147	B1AZP2.pdb.gz	DLGP4_MOUSE Disks large-associated protein 4 OS=Mus musculus OX=10090 GN=Dlgap4 PE=1 SV=1
6	PDB:3geiC	0.057	0.142	2.763E-1	298	0.021	0.067	3geiC.pdb.gz
7	AFDB:P97836	0.087	0.084	2.832E-1	992	0.113	0.109	P97836.pdb.gz	DLGP1_RAT Disks large-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Dlgap1 PE=1 SV=1
8	AFDB:E9Q7D5	0.070	0.050	3.108E-1	1581	0.120	0.072	E9Q7D5.pdb.gz	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
9	PDB:7yqcA	0.083	0.312	3.329E-1	198	0.019	0.091	7yqcA.pdb.gz
10	AFDB:P97837	0.084	0.077	3.412E-1	1059	0.157	0.141	P97837.pdb.gz	DLGP2_RAT Disks large-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Dlgap2 PE=1 SV=3
11	PDB:6xz6A	0.055	0.196	4.010E-1	213	0.024	0.108	6xz6A.pdb.gz
12	PDB:1ggqA	0.072	0.267	4.402E-1	162	0.021	0.123	1ggqA.pdb.gz
13	AFDB:Q8GY51	0.074	0.069	4.951E-1	1059	0.142	0.127	Q8GY51.pdb.gz	Q8GY51_ARATH At4g15730 OS=Arabidopsis thaliana OX=3702 GN=DL3905C PE=2 SV=1
14	AFDB:F4HWC3	0.060	0.045	6.249E-1	1364	0.126	0.088	F4HWC3.pdb.gz	F4HWC3_ARATH Calponin-like domain protein OS=Arabidopsis thaliana OX=3702 GN=At1g20970 PE=1 SV=1
15	PDB:7naod	0.083	0.247	6.693E-1	217	0.021	0.092	7naod.pdb.gz
16	PDB:4kxrB	0.072	0.324	7.696E-1	174	0.029	0.161	4kxrB.pdb.gz
17	PDB:7s7gA	0.082	0.128	7.696E-1	571	0.028	0.047	7s7gA.pdb.gz	Crystal Structure Analysis of Human VLCAD
18	PDB:1tr2B	0.084	0.078	1.410	1029	0.026	0.024	1tr2B.pdb.gz
19	PDB:2bidA	0.050	0.152	1.547	197	0.035	0.168	2bidA.pdb.gz
20	PDB:6elzb	0.066	0.105	1.547	421	0.022	0.050	6elzb.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AG06	0.0	1738	965	0.886	0.874	MEIOC_MOUSE Meiosis-specific coiled-coil domain-containing protein MEIOC OS=Mus musculus OX=10090 GN=Meioc PE=1 SV=1
2	Q0WPF2	2.5	34.3	808	0.024	0.028	PCFS4_ARATH Polyadenylation and cleavage factor homolog 4 OS=Arabidopsis thaliana OX=3702 GN=PCFS4 PE=1 SV=1
3	Q8CF31	6.3	30.8	99	0.015	0.141	FREY_MOUSE Protein Frey OS=Mus musculus OX=10090 GN=Frey1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17095 CAMSAP_CC1	7.7e+02	11.4	Spectrin-binding region of Ca2+-Calmodulin
2	PF15189 MEIOC	5.9e-80	278.3	Meiosis-specific coiled-coil domain-containing protein MEIOC

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386452

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000161863	0.961	Probable ATP-dependent RNA helicase YTHDC2
2	9606.ENSP00000339245	0.703	YTH domain-containing protein 1
3	9606.ENSP00000359364	0.655	YTH domain-containing family protein 1
4	9606.ENSP00000362918	0.620	YTH domain-containing family protein 2
5	9606.ENSP00000264951	0.606	5'-3' exoribonuclease 1
6	9606.ENSP00000296513	0.602	Adenosine deaminase domain-containing protein 1
7	9606.ENSP00000463762	0.601	Telomere repeats-binding bouquet formation protein 1
8	9606.ENSP00000478490	0.590	YTH domain-containing family protein 3
9	9606.ENSP00000293695	0.542	Synaptonemal complex central element protein 2
10	9606.ENSP00000385480	0.541	Synaptonemal complex central element protein 3
11	9606.ENSP00000323782	0.524	Coiled-coil domain containing 43
12	9606.ENSP00000310303	0.523	Testis- and ovary-specific PAZ domain-containing protein 1
13	9606.ENSP00000274361	0.518	Putative ankyrin repeat domain-containing protein 31
14	9606.ENSP00000269142	0.513	Transcription initiation factor TFIID subunit 4B
15	9606.ENSP00000350036	0.512	Structural maintenance of chromosomes protein 1B
16	9606.ENSP00000007699	0.505	Y-box-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071840	0.978	cellular component organization or biogenesis
GO:0050794	0.978	regulation of cellular process
GO:0016043	0.974	cellular component organization
GO:0071704	0.973	organic substance metabolic process
GO:0044238	0.967	primary metabolic process
GO:0044237	0.967	cellular metabolic process
GO:0051171	0.965	regulation of nitrogen compound metabolic process
GO:0006996	0.964	organelle organization
GO:0022414	0.962	reproductive process
GO:0006807	0.960	nitrogen compound metabolic process
GO:0080090	0.960	regulation of primary metabolic process
GO:0031323	0.960	regulation of cellular metabolic process
GO:0009892	0.960	negative regulation of metabolic process
GO:0010468	0.957	regulation of gene expression
GO:0043170	0.955	macromolecule metabolic process
GO:0034641	0.951	cellular nitrogen compound metabolic process
GO:0090304	0.941	nucleic acid metabolic process
GO:0022607	0.940	cellular component assembly
GO:1903311	0.928	regulation of mRNA metabolic process
GO:0010605	0.927	negative regulation of macromolecule metabolic process
GO:0048523	0.916	negative regulation of cellular process
GO:0007276	0.908	gamete generation
GO:0048522	0.893	positive regulation of cellular process
GO:0007127	0.893	meiosis I
GO:0070192	0.888	chromosome organization involved in meiotic cell cycle
GO:0045132	0.888	meiotic chromosome segregation
GO:0045143	0.833	homologous chromosome segregation
GO:0032502	0.818	developmental process
GO:0031324	0.818	negative regulation of cellular metabolic process
GO:0010604	0.805	positive regulation of macromolecule metabolic process
GO:0010608	0.776	post-transcriptional regulation of gene expression
GO:0003006	0.775	developmental process involved in reproduction
GO:0048232	0.775	male gamete generation
GO:0007129	0.769	homologous chromosome pairing at meiosis
GO:0048856	0.766	anatomical structure development
GO:0022412	0.766	cellular process involved in reproduction in multicellular organism
GO:0030154	0.749	cell differentiation
GO:0010628	0.724	positive regulation of gene expression
GO:0051172	0.668	negative regulation of nitrogen compound metabolic process
GO:0044260	0.613	cellular macromolecule metabolic process
GO:2000241	0.554	regulation of reproductive process
GO:0065008	0.509	regulation of biological quality
GO:0043488	0.480	regulation of mRNA stability
GO:0050896	0.464	response to stimulus
GO:0007283	0.447	spermatogenesis
GO:0070193	0.332	synaptonemal complex organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0070013	0.858	intracellular organelle lumen
GO:0031981	0.734	nuclear lumen
GO:0032991	0.405	protein-containing complex
GO:0005654	0.364	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]