StarFunc result for job id A2RUC4

User Input

>input (315 residues)
MAGQHLPVPRLEGVSREQFMQHLYPQRKPLVLEGIDLGPCTSKWTVDYLSQVGGKKEVKI
HVAAVAQMDFISKNFVYRTLPFDQLVQRAAEEKHKEFFVSEDEKYYLRSLGEDPRKDVAD
IRKQFPLLKGDIKFPEFFKEEQFFSSVFRISSPGLQLWTHYDVMDNLLIQVTGKKRVVLF
SPRDAQYLYLKGTKSEVLNIDNPDLAKYPLFSKARRYECSLEAGDVLFIPALWFHNVISE
EFGVGVNIFWKHLPSECYDKTDTYGNKDPTAASRAAQILDRALKTLAELPEEYRDFYARR
MVLHIQDKAYSKNSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2RUC4	1.000	1.000	1.007E-71	315	1.000	1.000	A2RUC4.pdb.gz	TYW5_HUMAN tRNA wybutosine-synthesizing protein 5 OS=Homo sapiens OX=9606 GN=TYW5 PE=1 SV=1
2	PDB:3al5B	0.972	0.985	1.118E-63	311	0.987	1.000	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
3	PDB:3al5C	0.886	0.981	2.245E-54	284	0.902	1.000	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
4	AFDB:Q38DD6	0.871	0.250	7.097E-36	1145	0.365	0.100	Q38DD6.pdb.gz	Q38DD6_TRYB2 tRNA wybutosine-synthesizing protein 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3730 PE=3 SV=1
5	AFDB:Q9CXT6	0.654	0.502	1.023E-23	414	0.235	0.179	Q9CXT6.pdb.gz	KDM8_MOUSE Bifunctional peptidase and arginyl-hydroxylase JMJD5 OS=Mus musculus OX=10090 GN=Kdm8 PE=1 SV=1
6	AFDB:A0A0S2Z5T1	0.658	0.504	4.625E-23	416	0.213	0.161	A0A0S2Z5T1.pdb.gz	A0A0S2Z5T1_HUMAN Jumonji domain containing 5 (Fragment) OS=Homo sapiens OX=9606 GN=JMJD5 PE=2 SV=1
7	AFDB:Q8RWR1	0.674	0.500	1.835E-21	429	0.203	0.149	Q8RWR1.pdb.gz	JMJ30_ARATH Lysine-specific demethylase JMJ30 OS=Arabidopsis thaliana OX=3702 GN=JMJ30 PE=1 SV=1
8	PDB:4b7eA	0.644	0.588	1.837E-21	349	0.235	0.212	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
9	AFDB:Q9W0M3	0.653	0.519	2.070E-21	401	0.210	0.165	Q9W0M3.pdb.gz	Q9W0M3_DROME GM21055p OS=Drosophila melanogaster OX=7227 GN=JMJD5 PE=2 SV=2
10	AFDB:P59723	0.656	0.606	5.436E-21	344	0.232	0.212	P59723.pdb.gz	HIF1N_DANRE Hypoxia-inducible factor 1-alpha inhibitor OS=Danio rerio OX=7955 GN=hif1an PE=2 SV=2
11	AFDB:Q8BLR9	0.642	0.586	9.357E-21	349	0.241	0.218	Q8BLR9.pdb.gz	HIF1N_MOUSE Hypoxia-inducible factor 1-alpha inhibitor OS=Mus musculus OX=10090 GN=Hif1an PE=1 SV=2
12	PDB:5nfnB	0.616	0.611	5.670E-19	318	0.200	0.198	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
13	PDB:4qszA	0.609	0.292	9.187E-19	686	0.197	0.090	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
14	AFDB:Q9VU77	0.630	0.628	3.258E-18	316	0.181	0.180	Q9VU77.pdb.gz	Q9VU77_DROME GH14974p OS=Drosophila melanogaster OX=7227 GN=JMJD7 PE=1 SV=1
15	AFDB:Q96EW2	0.603	0.404	4.148E-18	488	0.203	0.131	Q96EW2.pdb.gz	HBAP1_HUMAN HSPB1-associated protein 1 OS=Homo sapiens OX=9606 GN=HSPBAP1 PE=1 SV=1
16	PDB:7yxgA	0.644	0.648	7.592E-18	313	0.194	0.195	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
17	PDB:4cclB	0.454	0.393	3.018E-10	372	0.152	0.129	4cclB.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
18	PDB:4bxfA	0.470	0.364	1.826E-8	425	0.159	0.118	4bxfA.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
19	PDB:4bu2A	0.384	0.327	1.703E-7	379	0.137	0.113	4bu2A.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
20	PDB:1ipkC	0.255	0.214	9.134E-6	379	0.073	0.061	1ipkC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RUC4	0.0	654	315	1.000	1.000	TYW5_HUMAN tRNA wybutosine-synthesizing protein 5 OS=Homo sapiens OX=9606 GN=TYW5 PE=1 SV=1
2	Q38DD6	2.82e-55	195	1145	0.346	0.095	Q38DD6_TRYB2 tRNA wybutosine-synthesizing protein 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3730 PE=3 SV=1
3	Q9CXT6	1.06e-25	107	414	0.229	0.174	KDM8_MOUSE Bifunctional peptidase and arginyl-hydroxylase JMJD5 OS=Mus musculus OX=10090 GN=Kdm8 PE=1 SV=1
4	A0A0S2Z5T1	5.98e-23	100	416	0.213	0.161	A0A0S2Z5T1_HUMAN Jumonji domain containing 5 (Fragment) OS=Homo sapiens OX=9606 GN=JMJD5 PE=2 SV=1
5	Q8N371	5.98e-23	100	416	0.213	0.161	KDM8_HUMAN Bifunctional peptidase and arginyl-hydroxylase JMJD5 OS=Homo sapiens OX=9606 GN=KDM8 PE=1 SV=1
6	Q9W0M3	1.87e-19	90.1	401	0.238	0.187	Q9W0M3_DROME GM21055p OS=Drosophila melanogaster OX=7227 GN=JMJD5 PE=2 SV=2
7	Q96EW2	3.28e-15	78.2	488	0.216	0.139	HBAP1_HUMAN HSPB1-associated protein 1 OS=Homo sapiens OX=9606 GN=HSPBAP1 PE=1 SV=1
8	Q9NWT6	6.56e-14	73.6	349	0.225	0.203	HIF1N_HUMAN Hypoxia-inducible factor 1-alpha inhibitor OS=Homo sapiens OX=9606 GN=HIF1AN PE=1 SV=2
9	Q8BLR9	1.11e-13	72.8	349	0.225	0.203	HIF1N_MOUSE Hypoxia-inducible factor 1-alpha inhibitor OS=Mus musculus OX=10090 GN=Hif1an PE=1 SV=2
10	Q8RWR1	2.14e-13	72.4	429	0.213	0.156	JMJ30_ARATH Lysine-specific demethylase JMJ30 OS=Arabidopsis thaliana OX=3702 GN=JMJ30 PE=1 SV=1
11	Q9VU77	1.31e-11	66.6	316	0.210	0.209	Q9VU77_DROME GH14974p OS=Drosophila melanogaster OX=7227 GN=JMJD7 PE=1 SV=1
12	P59723	2.84e-11	65.9	344	0.124	0.113	HIF1N_DANRE Hypoxia-inducible factor 1-alpha inhibitor OS=Danio rerio OX=7955 GN=hif1an PE=2 SV=2
13	P0C870	6.48e-11	64.3	316	0.190	0.190	JMJD7_HUMAN Bifunctional peptidase and (3S)-lysyl hydroxylase JMJD7 OS=Homo sapiens OX=9606 GN=JMJD7 PE=1 SV=1
14	Q67XX3	2.17e-07	54.3	502	0.213	0.133	JMJ22_ARATH Arginine-specific demethylase JMJ22 OS=Arabidopsis thaliana OX=3702 GN=JMJ22 PE=1 SV=1
15	Q67ZB6	3.03e-06	50.8	462	0.117	0.080	JMJ20_ARATH Arginine-specific demethylase JMJ20 OS=Arabidopsis thaliana OX=3702 GN=JMJ20 PE=1 SV=1
16	Q9VB06	5.16e-06	50.1	398	0.114	0.090	Q9VB06_DROME HSPB1 associated protein 1 OS=Drosophila melanogaster OX=7227 GN=HSPBAP1 PE=4 SV=3
17	Q0WVR4	1.45e-05	48.5	345	0.108	0.099	JMJ32_ARATH Lysine-specific demethylase JMJ32 OS=Arabidopsis thaliana OX=3702 GN=JMJ32 PE=1 SV=1
18	Q96S16	0.011	39.3	264	0.070	0.083	JMJD8_HUMAN JmjC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=JMJD8 PE=1 SV=2
19	Q7K4H4	0.012	39.7	653	0.092	0.044	NO66_DROME Bifunctional lysine-specific demethylase and histidyl-hydroxylase NO66 OS=Drosophila melanogaster OX=7227 GN=NO66 PE=1 SV=1
20	Q9LNJ9	0.068	37.4	1055	0.127	0.038	FKGP_ARATH Bifunctional fucokinase/fucose pyrophosphorylase OS=Arabidopsis thaliana OX=3702 GN=FKGP PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13621 Cupin_8	1.1e-38	145.1	Cupin-like domain
2	PF02373 JmjC	43	16.0	JmjC domain, hydroxylase
3	PF08007 JmjC_2	5.3e-05	34.2	JmjC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000008407

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000022866	0.801	tRNA methyltransferase 12 homolog (S. cerevisiae)
2	61853.ENSNLEP00000016083	0.794	Uncharacterized protein
3	61853.ENSNLEP00000011638	0.697	tRNA-yW synthesizing protein 3 homolog (S. cerevisiae)
4	61853.ENSNLEP00000008420	0.692	Spermatogenesis associated, serine-rich 2-like
5	61853.ENSNLEP00000008449	0.667	Basic leucine zipper and W2 domains 1
6	61853.ENSNLEP00000008421	0.638	Potassium channel tetramerization domain containing 18
7	61853.ENSNLEP00000014207	0.637	yrdC N(6)-threonylcarbamoyltransferase domain containing
8	61853.ENSNLEP00000020347	0.622	AlkB homolog 1, histone H2A dioxygenase
9	61853.ENSNLEP00000008403	0.578	Chromosome 2 open reading frame 69
10	61853.ENSNLEP00000016753	0.569	tRNA (guanine(37)-N1)-methyltransferase
11	61853.ENSNLEP00000018321	0.559	Adenosine deaminase, tRNA-specific 2
12	61853.ENSNLEP00000002390	0.547	Adenosine deaminase, tRNA-specific 3
13	61853.ENSNLEP00000002560	0.547	Ribosomal oxygenase 2
14	61853.ENSNLEP00000008799	0.529	AlkB homolog 8, tRNA methyltransferase
15	61853.ENSNLEP00000024451	0.508	Solute carrier family 38, member 7
16	61853.ENSNLEP00000017120	0.504	Jumonji domain containing 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140101	1.000	catalytic activity, acting on a tRNA
GO:0042803	1.000	protein homodimerization activity
GO:0016706	1.000	2-oxoglutarate-dependent dioxygenase activity
GO:0005506	1.000	iron ion binding
GO:0000049	1.000	tRNA binding
GO:0102524	0.873	tRNAPhe (7-(3-amino-3-carboxypropyl)wyosine37-C2)-hydroxylase activity
GO:0140096	0.579	catalytic activity, acting on a protein
GO:0032451	0.528	demethylase activity
GO:0140457	0.342	protein demethylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006807	0.996	nitrogen compound metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0043412	0.987	macromolecule modification
GO:0008033	0.987	tRNA processing
GO:0009451	0.984	RNA modification
GO:1901137	0.966	carbohydrate derivative biosynthetic process
GO:1901659	0.964	glycosyl compound biosynthetic process
GO:0006400	0.936	tRNA modification
GO:1901564	0.691	organonitrogen compound metabolic process
GO:0050789	0.548	regulation of biological process
GO:0050794	0.504	regulation of cellular process
GO:1901566	0.386	organonitrogen compound biosynthetic process
GO:0019222	0.307	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.959	intracellular membrane-bounded organelle
GO:0005634	0.953	nucleus
GO:0070013	0.950	intracellular organelle lumen
GO:0031981	0.784	nuclear lumen
GO:0005654	0.516	nucleoplasm
GO:0005829	0.339	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.11.-	1.000	With 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors.
RHEA:37899	0.873	2-oxoglutarate + 7-[(3S)-3-amino-3-carboxypropyl]wyosine(37) in tRNA(Phe) + O2 = 7-(2-hydroxy-3-amino-3-carboxypropyl)wyosine(37) in tRNA(Phe) + CO2 + succinate
EC:1.14.11.42	0.873	tRNA(Phe) (7-(3-amino-3-carboxypropyl)wyosine(37)-C(2))-hydroxylase.

[back to server]