StarFunc result for job id A2RUH7

User Input

>input (354 residues)
MEAATAPEVAAGSKLKVKEASPADAEPPQASPGQGAGSPTPQLLPPIEEHPKIWLPRALR
QTYIRKVGDTVNLLIPFQGKPKPQAIWTHDGCALDTRRVSVRNGEQDSILFIREAQRADS
GRYQLRVQLGGLEATATIDILVIERPGPPQSIKLVDVWGFSATLEWTPPQDTGNTALLGY
TVQKADTKSGLWFTVLEHYHRTSCIVSDLIIGNSYAFRVFAENQCGLSETAPITTDLAHI
QKAATVYKTKGFAQRDFSEAPKFTQPLADCTTVTGYNTQLFCCVRASPRPKIIWLKNKMD
IQGNPKYRALTHLGICSLEIRKPGPFDGGIYTCKAVNPLGEASVDCRVDVKVPN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2RUH7	1.000	1.000	4.252E-66	354	1.000	1.000	A2RUH7.pdb.gz	MBPHL_HUMAN Myosin-binding protein H-like OS=Homo sapiens OX=9606 GN=MYBPHL PE=1 SV=2
2	AFDB:Q5FW53	0.611	0.610	1.050E-57	355	0.833	0.831	Q5FW53.pdb.gz	MBPHL_MOUSE Myosin-binding protein H-like OS=Mus musculus OX=10090 GN=Mybphl PE=1 SV=1
3	AFDB:Q13203	0.571	0.427	1.240E-48	477	0.627	0.465	Q13203.pdb.gz	MYBPH_HUMAN Myosin-binding protein H OS=Homo sapiens OX=9606 GN=MYBPH PE=1 SV=4
4	AFDB:E1C597	0.553	0.367	2.327E-46	537	0.551	0.363	E1C597.pdb.gz
5	AFDB:Q90688	0.550	0.189	1.724E-44	1272	0.492	0.137	Q90688.pdb.gz	MYPC3_CHICK Myosin-binding protein C, cardiac-type OS=Gallus gallus OX=9031 GN=MYBPC3 PE=1 SV=3
6	AFDB:A1L1W0	0.582	0.425	2.195E-43	523	0.466	0.315	A1L1W0.pdb.gz
7	AFDB:E7EZ79	0.629	0.208	2.944E-43	1266	0.466	0.130	E7EZ79.pdb.gz
8	AFDB:F1R6I7	0.579	0.205	5.560E-43	1111	0.452	0.144	F1R6I7.pdb.gz
9	AFDB:A0A1L1QZU5	0.781	0.229	1.103E-42	1287	0.469	0.129	A0A1L1QZU5.pdb.gz	A0A1L1QZU5_DANRE Myosin-binding protein C, cardiac-type isoform X4 OS=Danio rerio OX=7955 GN=hm:zehn0716 PE=1 SV=1
10	AFDB:A6QP89	0.544	0.186	4.133E-42	1198	0.489	0.144	A6QP89.pdb.gz	A6QP89_BOVIN MYBPC1 protein OS=Bos taurus OX=9913 GN=MYBPC1 PE=2 SV=1
11	PDB:6dldD	0.331	0.420	4.183E-12	269	0.138	0.182	6dldD.pdb.gz
12	PDB:1e07A	0.262	0.168	6.166E-11	642	0.133	0.073	1e07A.pdb.gz
13	PDB:5oj2B	0.293	0.168	6.475E-11	692	0.175	0.090	5oj2B.pdb.gz
14	PDB:6dlfA	0.352	0.497	2.676E-10	236	0.116	0.174	6dlfA.pdb.gz
15	PDB:6feyB	0.253	0.423	9.960E-8	207	0.116	0.198	6feyB.pdb.gz	Structures of insect Imp-L2 suggest an alternative strategy for regulating the bioavailability of insulin-like hormones.
16	PDB:1igaA	0.179	0.140	1.403E-7	475	0.133	0.099	1igaA.pdb.gz
17	PDB:1igtB	0.211	0.172	9.003E-7	444	0.121	0.097	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.
18	PDB:6pxvA	0.293	0.146	9.928E-7	823	0.127	0.055	6pxvA.pdb.gz
19	PDB:6pyhD	0.270	0.135	1.150E-6	798	0.113	0.050	6pyhD.pdb.gz
20	PDB:7sqcO0	0.208	0.080	1.332E-6	1140	0.085	0.026	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RUH7	0.0	732	354	1.000	1.000	MBPHL_HUMAN Myosin-binding protein H-like OS=Homo sapiens OX=9606 GN=MYBPHL PE=1 SV=2
2	Q5FW53	0.0	617	355	0.833	0.831	MBPHL_MOUSE Myosin-binding protein H-like OS=Mus musculus OX=10090 GN=Mybphl PE=1 SV=1
3	Q13203	7.02e-170	483	477	0.647	0.480	MYBPH_HUMAN Myosin-binding protein H OS=Homo sapiens OX=9606 GN=MYBPH PE=1 SV=4
4	Q05623	7.27e-149	432	537	0.559	0.369	MYBPH_CHICK Myosin-binding protein H OS=Gallus gallus OX=9031 GN=MYBPH PE=1 SV=1
5	F7D574	7.76e-130	377	362	0.475	0.464	F7D574_MOUSE Myosin binding protein C, slow-type (Fragment) OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
6	A6QP89	4.70e-127	394	1198	0.503	0.149	A6QP89_BOVIN MYBPC1 protein OS=Bos taurus OX=9913 GN=MYBPC1 PE=2 SV=1
7	Q90688	9.57e-127	395	1272	0.494	0.138	MYPC3_CHICK Myosin-binding protein C, cardiac-type OS=Gallus gallus OX=9031 GN=MYBPC3 PE=1 SV=3
8	Q00872	1.89e-124	386	1141	0.489	0.152	MYPC1_HUMAN Myosin-binding protein C, slow-type OS=Homo sapiens OX=9606 GN=MYBPC1 PE=1 SV=2
9	Q6P6L5	3.37e-122	380	1124	0.477	0.150	Q6P6L5_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
10	D3YU50	5.18e-122	379	1127	0.477	0.150	D3YU50_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
11	A0A571BEN1	2.95e-121	378	1139	0.475	0.147	A0A571BEN1_MOUSE Myosin binding protein C, slow-type OS=Mus musculus OX=10090 GN=Mybpc1 PE=1 SV=1
12	A0A1L1QZU5	1.41e-120	379	1287	0.469	0.129	A0A1L1QZU5_DANRE Myosin-binding protein C, cardiac-type isoform X4 OS=Danio rerio OX=7955 GN=hm:zehn0716 PE=1 SV=1
13	Q5U3B1	5.41e-115	362	1168	0.452	0.137	Q5U3B1_DANRE Myosin-binding protein C, slow-type OS=Danio rerio OX=7955 GN=zgc:92073 PE=1 SV=1
14	Q5XKE0	6.76e-113	355	1136	0.449	0.140	MYPC2_MOUSE Myosin-binding protein C, fast-type OS=Mus musculus OX=10090 GN=Mybpc2 PE=1 SV=1
15	Q5BJ14	1.07e-111	352	1111	0.455	0.145	Q5BJ14_DANRE Zgc:110761 OS=Danio rerio OX=7955 GN=zgc:110761 PE=2 SV=1
16	Q14324	5.16e-111	350	1141	0.444	0.138	MYPC2_HUMAN Myosin-binding protein C, fast-type OS=Homo sapiens OX=9606 GN=MYBPC2 PE=1 SV=2
17	O70468	3.20e-110	350	1270	0.460	0.128	MYPC3_MOUSE Myosin-binding protein C, cardiac-type OS=Mus musculus OX=10090 GN=Mybpc3 PE=1 SV=1
18	Q14896	6.75e-110	350	1274	0.458	0.127	MYPC3_HUMAN Myosin-binding protein C, cardiac-type OS=Homo sapiens OX=9606 GN=MYBPC3 PE=1 SV=4
19	P16419	1.17e-108	344	1132	0.446	0.140	MYPC2_CHICK Myosin-binding protein C, fast-type OS=Gallus gallus OX=9031 GN=MYBPC2 PE=1 SV=3
20	P56741	9.67e-108	344	1274	0.455	0.126	MYPC_RAT Myosin-binding protein C, cardiac-type OS=Rattus norvegicus OX=10116 GN=Mybpc3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00041 fn3	4e-09	48.0	Fibronectin type III domain
2	PF01688 Herpes_gI	3.3e+02	12.6	Alphaherpesvirus glycoprotein I
3	PF07679 I-set	6.1e-25	98.4	Immunoglobulin I-set domain
4	PF00047 ig	0.019	26.5	Immunoglobulin domain
5	PF13895 Ig_2	4.4e-05	35.0	Immunoglobulin domain
6	PF13927 Ig_3	2e-13	62.0	Immunoglobulin domain
7	PF04203 Sortase	6e+02	11.6	Sortase domain
8	PF07686 V-set	0.01	27.4	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349678

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358925	0.722	Proline/serine-rich coiled-coil protein 1
2	9606.ENSP00000271332	0.707	Cadherin EGF LAG seven-pass G-type receptor 2
3	9606.ENSP00000463245	0.697	Functions as a negative regulator of MYRF in oligodendrocyte differentiation and myelination. Interacts with the C-terminal of MYRF inhibiting MYRF self-cleavage and N-fragment nuclear translocation. The secreted form promotes differentiation of T helper 1 cells (Th1).
4	9606.ENSP00000306100	0.684	Peptidyl-glycine alpha-amidating monooxygenase
5	9606.ENSP00000256637	0.635	Sortilin
6	9606.ENSP00000259239	0.627	U3 small nucleolar ribonucleoprotein protein IMP4
7	9606.ENSP00000278937	0.584	Myelin protein zero-like protein 2
8	9606.ENSP00000272203	0.573	Pleckstrin homology domain containing A6
9	9606.ENSP00000257863	0.527	Anti-Muellerian hormone type-2 receptor
10	9606.ENSP00000371529	0.518	Uncharacterized protein C22orf42
11	9606.ENSP00000261978	0.508	Latent-transforming growth factor beta-binding protein 2
12	9606.ENSP00000239926	0.507	Myotilin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.416	signaling receptor activity
GO:0004888	0.400	transmembrane signaling receptor activity
GO:0005198	0.378	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.957	developmental process
GO:0032501	0.929	multicellular organismal process
GO:0048856	0.830	anatomical structure development
GO:0065007	0.825	biological regulation
GO:0050789	0.823	regulation of biological process
GO:0009987	0.604	cellular process
GO:0050794	0.534	regulation of cellular process
GO:0007275	0.435	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0099080	0.995	supramolecular complex
GO:0043292	0.992	contractile fiber
GO:0030016	0.981	myofibril
GO:0036379	0.908	myofilament
GO:0043227	0.801	membrane-bounded organelle
GO:0043231	0.602	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]