StarFunc result for job id A2RUR9

User Input

>input (1427 residues)
MASWGGEKRGGAEGSPKPAVYATRKTPSVGSQGDQWYLGYPGDQWSSGFPYSWWKNSVGS
ESKHGEGALDQPQHDVRLEDLGELHRAARSGDVPGVEHILAPGDTGVDKRDRKKSIQQLV
PEYKEKQTPESLPQNNNPDWHPTNLTLSDETCQRSKNLKVDDKCPSVSPSMPENQSATKE
LGQMNLTEREKMDTGVVLLSGNDTLHDLCQSQLPENKESKEAEQDSELTSEEEQERLKGC
ENKQPQKTSQEPEMAKDCDREDIPIYPVLPHVQKSEEMWIEQGKLEWKNQLKLVINELKQ
RFGEIYEKYKIPACPEEEPLLDNSTRGTDVKDIPFNLTNNIPGCEEEDASEISVSVVFET
FPEQKEPSLKNIIHPYYHPYSGSQEHVCQSSSKFHLHENKLDCDNDNKPGIGHIFSTDKN
FHNDASTKKARNPEVVMVEMKEDQEFDLQMTKNMNQNSDSGSTNNYKSLKPKLENLSSLP
PDSDRTSEVYLHEELQQDMQKFKNEVNTLEEEFLALKKEDVQLHKDVEEEMEKHRSNSTE
LSGTLTDGTTVGNDDDGLNQQIPRKENGEHDRPADKTSNEKNEVKNQIYPEADFADSMEP
SEIASEDCELSHSVYENFMLLIEQLRMEYKDSASLPRIQDTFCLCEHLLKLKNNHCDQLT
VKLKQMENMVSVLQNELSETKKTKLQLELQKIEWEKELYDLRLALKQENEEKRNADMLYN
KDSEQLRIKEEECGKVVETKQQLKWNLRRLVKELRTVRNNLDLVVQERNDAQKQLSEEQD
ARILQDQILTSKQKELEMARKKMNSEISHRHQKEKDLFHEDCMLQEEIALLRLEIDTIKN
QNKQKEKKYFEDIEAVKEKNDNLQKIIKLNEETLTETILQYSGQLNNLTAENKILNSELE
NGKQNQERLEIEMESYRCRLAAAVRDCDQSQTARDLKLDFQRTRQEWVRLHDKMKVDMSG
LQAKNEILSEKLSNAESKINSLQIQLHNTRDALGRESLILERVQRDLSQTQCQKKETEQM
YQIEQSKLKKYIAKQESVEERLSQLQSENMLLRQQLDDAHKKANSQEKTSSTIQDQFHSA
AKNLQAESEKQILSLQEKNKELMDEYNHLKERMDQCEKEKAGRKIDLTEAQETVPSRCLH
LDAENEVLQLQQTLFSMKAIQKQCETLQKNKKQLKQEVVNLKSYMERNMLERGKAEWHKL
LIEERARKEIEEKLNEAILTLQKQAAVSHEQLVQLREDNTTSIKTQMELTIKDLESEISR
IKTSQADFNKTELERYKELYLEEVKVRESLSNELSRTNEMIAEVSTQLTVEKEQTRSRSL
FTAYATRPVLESPCVGNLNDSEGLNRKHIPRKKRSALKDMESYLLKMQQKLQNDLTAEVA
GSSQTGLHRIPQCSSFSSSSLHLLLCSICQPFFLILQLLLNMNLDPI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9UPS8	0.109	0.093	1.875E-67	1710	0.413	0.345	Q9UPS8.pdb.gz	ANR26_HUMAN Ankyrin repeat domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ANKRD26 PE=1 SV=4
2	AFDB:Q811D2	0.112	0.102	3.763E-51	1581	0.339	0.306	Q811D2.pdb.gz	ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus OX=10090 GN=Ankrd26 PE=1 SV=2
3	AFDB:Q8N2N9	0.108	0.113	3.704E-29	1353	0.221	0.234	Q8N2N9.pdb.gz	AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens OX=9606 GN=ANKRD36B PE=1 SV=4
4	AFDB:A0A024R370	0.088	0.112	2.078E-13	1093	0.149	0.194	A0A024R370.pdb.gz
5	AFDB:Q5TB80	0.058	0.059	3.930E-13	1403	0.149	0.152	Q5TB80.pdb.gz	CE162_HUMAN Centrosomal protein of 162 kDa OS=Homo sapiens OX=9606 GN=CEP162 PE=1 SV=2
6	AFDB:Q0VF96	0.099	0.107	3.791E-12	1302	0.154	0.169	Q0VF96.pdb.gz	CGNL1_HUMAN Cingulin-like protein 1 OS=Homo sapiens OX=9606 GN=CGNL1 PE=1 SV=2
7	AFDB:B9EKI3	0.087	0.112	2.227E-11	1091	0.131	0.171	B9EKI3.pdb.gz	TMF1_MOUSE TATA element modulatory factor OS=Mus musculus OX=10090 GN=Tmf1 PE=1 SV=2
8	AFDB:Q6ZQ06	0.056	0.057	2.754E-11	1403	0.160	0.163	Q6ZQ06.pdb.gz	CE162_MOUSE Centrosomal protein of 162 kDa OS=Mus musculus OX=10090 GN=Cep162 PE=1 SV=2
9	AFDB:Q5DU05	0.101	0.100	3.925E-11	1446	0.148	0.146	Q5DU05.pdb.gz	CE164_MOUSE Centrosomal protein of 164 kDa OS=Mus musculus OX=10090 GN=Cep164 PE=1 SV=2
10	AFDB:Q9PTD7	0.094	0.098	9.182E-11	1360	0.151	0.159	Q9PTD7.pdb.gz	CING_XENLA Cingulin OS=Xenopus laevis OX=8355 GN=cgn PE=1 SV=3
11	PDB:7r5jV0	0.037	0.174	4.749E-1	273	0.031	0.161	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:3k2sA	0.035	0.147	2.256	243	0.025	0.148	3k2sA.pdb.gz	Double superhelix model of high density lipoprotein.
13	PDB:1kkcA	0.015	0.109	3.975	200	0.004	0.030	1kkcA.pdb.gz	Comparison of the crystal structures of the human manganese superoxide dismutase and the homologous Aspergillus fumigatus allergen at 2-A resolution.
14	PDB:5mntB	0.017	0.056	5.665	421	0.006	0.021	5mntB.pdb.gz
15	PDB:5wlcNB	0.029	0.204	7.006	142	0.013	0.127	5wlcNB.pdb.gz	The complete structure of the small-subunit processome.
16	PDB:7wttt	0.016	0.164	7.006	59	0.008	0.203	7wttt.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
17	PDB:6nr7A	0.022	0.025	7.520	1086	0.011	0.015	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling
18	PDB:4v60A	0.051	0.084	8.664	812	0.027	0.048	4v60A.pdb.gz
19	PDB:7enah	0.025	0.165	9.300	190	0.009	0.068	7enah.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9UPS8	0.0	672	1710	0.265	0.221	ANR26_HUMAN Ankyrin repeat domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ANKRD26 PE=1 SV=4
2	Q811D2	1.50e-153	508	1581	0.201	0.182	ANR26_MOUSE Ankyrin repeat domain-containing protein 26 OS=Mus musculus OX=10090 GN=Ankrd26 PE=1 SV=2
3	Q8N2N9	3.51e-94	335	1353	0.162	0.171	AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens OX=9606 GN=ANKRD36B PE=1 SV=4
4	Q5TYW2	1.09e-67	248	823	0.127	0.220	A20A1_HUMAN Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens OX=9606 GN=ANKRD20A1 PE=2 SV=1
5	A0JP26	2.33e-26	118	581	0.046	0.114	POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens OX=9606 GN=POTEB3 PE=1 SV=2
6	P0CG39	1.97e-25	117	1038	0.042	0.058	POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens OX=9606 GN=POTEJ PE=3 SV=1
7	Q6S8J3	2.09e-25	117	1075	0.043	0.057	POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens OX=9606 GN=POTEE PE=2 SV=3
8	A5A3E0	3.73e-25	116	1075	0.042	0.056	POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens OX=9606 GN=POTEF PE=1 SV=2
9	Q96IX9	5.97e-25	103	119	0.041	0.496	A26L1_HUMAN Putative ankyrin repeat domain-containing protein 26-like 1 OS=Homo sapiens OX=9606 GN=ANKRD36BP1 PE=5 SV=1
10	P0CG38	6.32e-25	115	1075	0.042	0.056	POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens OX=9606 GN=POTEI PE=3 SV=1
11	Q8IWJ2	0.078	40.0	1684	0.048	0.041	GCC2_HUMAN GRIP and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GCC2 PE=1 SV=4
12	Q9P1Z2	0.15	38.9	691	0.055	0.114	CACO1_HUMAN Calcium-binding and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CALCOCO1 PE=1 SV=2
13	Q9UPV9	0.22	38.5	953	0.046	0.068	TRAK1_HUMAN Trafficking kinesin-binding protein 1 OS=Homo sapiens OX=9606 GN=TRAK1 PE=1 SV=1
14	Q99104	0.78	37.0	1853	0.036	0.028	MYO5A_MOUSE Unconventional myosin-Va OS=Mus musculus OX=10090 GN=Myo5a PE=1 SV=2
15	Q8CGU1	0.99	36.2	691	0.069	0.142	CACO1_MOUSE Calcium-binding and coiled-coil domain-containing protein 1 OS=Mus musculus OX=10090 GN=Calcoco1 PE=1 SV=2
16	D3ZYD7	2.1	35.4	1523	0.041	0.038	D3ZYD7_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=1 SV=4
17	Q80Z25	2.2	35.4	1017	0.043	0.061	OFD1_MOUSE Centriole and centriolar satellite protein OFD1 OS=Mus musculus OX=10090 GN=Ofd1 PE=1 SV=1
18	A0A8I6A5W7	2.3	35.4	1873	0.041	0.031	A0A8I6A5W7_RAT Coiled coil domain containing 88A OS=Rattus norvegicus OX=10116 GN=Ccdc88a PE=4 SV=1
19	Q5HZI1	2.3	35.0	1210	0.041	0.048	MTUS1_MOUSE Microtubule-associated tumor suppressor 1 homolog OS=Mus musculus OX=10090 GN=Mtus1 PE=1 SV=2
20	Q9LSB9	2.4	35.0	755	0.036	0.068	EREX_ARATH PX domain-containing protein EREX OS=Arabidopsis thaliana OX=3702 GN=EREX PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14915 CCDC144C	2.8e-127	435.6	CCDC144C protein coiled-coil region
2	PF12001 DUF3496	8.7e-42	153.3	Domain of unknown function (DUF3496)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353717

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000410111	0.642	TBC1 domain family member 26
2	9606.ENSP00000437812	0.632	Protein FAM106A
3	9606.ENSP00000312141	0.630	Zinc finger protein 654
4	9606.ENSP00000382000	0.630	CMT1A duplicated region transcript 15 like 2
5	9606.ENSP00000339973	0.619	TBC1 domain family member 28
6	9606.ENSP00000329522	0.605	Speedy protein E4
7	9606.ENSP00000269127	0.582	Uncharacterized protein C17orf64
8	9606.ENSP00000456861	0.574	TBC1 domain family member 3G
9	9606.ENSP00000379242	0.567	CMT1A duplicated region transcript 1 protein
10	9606.ENSP00000297307	0.561	Solute carrier family 35 member G3
11	9606.ENSP00000331466	0.561	Transmembrane protein 95
12	9606.ENSP00000396523	0.561	Solute carrier family 35 member G6
13	9606.ENSP00000352172	0.558	V-set and immunoglobulin domain containing 10
14	9606.ENSP00000386180	0.556	Olfactory receptor 3A2
15	9606.ENSP00000286398	0.547	Structural maintenance of chromosomes protein 2
16	9606.ENSP00000367157	0.542	Leucine-rich repeat-containing protein 3C
17	9606.ENSP00000330051	0.537	Major facilitator superfamily domain containing 6 like
18	9606.ENSP00000462799	0.533	TBC1 domain family member 29
19	9606.ENSP00000484556	0.521	TBC1 domain family member 3B
20	9606.ENSP00000301037	0.518	Uncharacterized serine/threonine-protein kinase SgK494

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.982	cellular process
GO:0050794	0.981	regulation of cellular process
GO:0071840	0.345	cellular component organization or biogenesis
GO:0016043	0.309	cellular component organization
GO:0032501	0.302	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005737	0.883	cytoplasm
GO:0016020	0.877	membrane
GO:0043227	0.856	membrane-bounded organelle
GO:0005856	0.817	cytoskeleton
GO:0005634	0.797	nucleus
GO:0015630	0.588	microtubule cytoskeleton
GO:0005815	0.583	microtubule organizing center
GO:0070013	0.325	intracellular organelle lumen
GO:0031981	0.319	nuclear lumen
GO:0005654	0.301	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]