StarFunc result for job id A2RUS2

User Input

>input (1198 residues)
MRSLRKKREKPRPEQWKGLPGPPRAPEPEDVAVPGGVDLLTLPQLCFPGGVCVATEPKED
CVHFLVLTDVCGNRTYGVVAQYYRPLHDEYCFYNGKTHRECPGCFVPFAVCVVSRFPYYN
SLKDCLSCLLALLKPCKDFEVDSHIKDFAAKLSLIPSPPPGPLHLVFNMKSLQIVLPARA
DPESPILDLDLHLPLLCFRPEKVLQILTCILTEQRIVFFSSDWALLTLVTECFMAYLYPL
QWQHPFVPILSDQMLDFVMAPTSFLMGCHLDHFEEVSKEADGLVLINIDHGSITYSKSTD
DNVDIPDVPLLAAQTFIQRVQSLQLHHELHAAHLLSSTDLKEGRAHRRSWQQKLNCQIQQ
TTLQLLVSIFRDVKNHLNYEHRVFNSEEFLKTRAPGDHQFYKQVLDTYMFHSFLKARLNR
RMDAFAQMDLDTQSEEDRINGMLLSPRRPTVEKRASRKSSHLHVTHRRMVVSMPNLQDIA
MPELAPRNSSLRLTDTAGCRGSSAVLNVTPKSPYTFKIPEIHFPLESKCVQAYHAHFVSM
LSEAMCFLAPDNSLLLARYLYLRGLVYLMQGQLLNALLDFQNLYKTDIRIFPTDLVKRTV
ESMSAPEWEGAEQAPELMRLISEILDKPHEASKLDDHVKKFKLPKKHMQLGDFMKRVQES
GIVKDASIIHRLFEALTVGQEKQIDPETFKDFYNCWKETEAEAQEVSLPWLVMEHLDKNE
CVCKLSSSVKTNLGVGKIAMTQKRLFLLTEGRPGYLEISTFRNIEEVRRTTTTFLLRRIP
TLKIRVASKKEVFEANLKTECDLWHLMVKEMWAGKKLADDHKDPHYVQQALTNVLLMDAV
VGTLQSPGAIYAASKLSYFDKMSNEMPMTLPETTLETLKHKINPSAGEAFPQAVDVLLYT
PGHLDPAEKVEDAHPKLWCALSEGKVTVFNASSWTIHQHSFKVGTAKVNCMVMADQNQVW
VGSEDSVIYIINVHSMSCNKQLTAHCSSVTDLIVQDGQEAPSNVYSCSMDGMVLVWNVST
LQVTSRFQLPRGGLTSIRLHGGRLWCCTGNSIMVMKMNGSLHQELKIEENFKDTSTSFLA
FQLLPEEEQLWAACAGRSEVYIWSLKDLAQPPQRVPLEDCSEINCMIRVKKQVWVGSRGL
GQGTPKGKIYVIDAERKTVEKELVAHMDTVRTLCSAEDRYVLSGSGREEGKVAIWKGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2RT67	0.939	0.884	0.000	1274	0.789	0.742	A2RT67.pdb.gz	DEND3_MOUSE DENN domain-containing protein 3 OS=Mus musculus OX=10090 GN=Dennd3 PE=1 SV=2
2	AFDB:A2RUS2	1.000	1.000	0.000	1198	1.000	1.000	A2RUS2.pdb.gz	DEND3_HUMAN DENN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=DENND3 PE=1 SV=2
3	AFDB:E7FG65	0.911	0.860	0.000	1270	0.517	0.487	E7FG65.pdb.gz
4	AFDB:E9QIS0	0.271	0.702	6.287E-35	452	0.173	0.458	E9QIS0.pdb.gz
5	AFDB:F1R0N2	0.166	0.609	7.507E-32	306	0.154	0.601	F1R0N2.pdb.gz
6	AFDB:Q8RXA7	0.268	0.270	3.552E-31	1187	0.163	0.164	Q8RXA7.pdb.gz	SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana OX=3702 GN=SCD1 PE=1 SV=1
7	AFDB:E7F320	0.202	0.929	3.152E-24	253	0.098	0.466	E7F320.pdb.gz
8	AFDB:Q86WG5	0.278	0.186	4.867E-20	1849	0.128	0.083	Q86WG5.pdb.gz	MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens OX=9606 GN=SBF2 PE=1 SV=1
9	AFDB:E9PXF8	0.281	0.185	9.230E-20	1872	0.128	0.082	E9PXF8.pdb.gz	MTMRD_MOUSE Myotubularin-related protein 13 OS=Mus musculus OX=10090 GN=Sbf2 PE=1 SV=1
10	AFDB:O02626	0.289	0.251	2.480E-18	1409	0.159	0.136	O02626.pdb.gz	MADD_CAEEL MAP kinase-activating death domain protein OS=Caenorhabditis elegans OX=6239 GN=aex-3 PE=1 SV=1
11	PDB:6ttuT	0.203	0.578	1.776E-14	394	0.051	0.155	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
12	PDB:7bt6x	0.196	0.441	5.829E-14	488	0.047	0.115	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
13	PDB:5yzgs	0.209	0.628	4.161E-13	374	0.055	0.176	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
14	PDB:5mzhB	0.209	0.545	4.996E-13	415	0.040	0.116	5mzhB.pdb.gz
15	PDB:5o9zL	0.223	0.541	1.087E-12	459	0.048	0.126	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
16	PDB:7mq8SG	0.207	0.602	1.246E-12	389	0.043	0.134	7mq8SG.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:3zwlD	0.202	0.618	2.364E-12	352	0.036	0.122	3zwlD.pdb.gz
18	PDB:5jcsq	0.194	0.440	3.733E-12	488	0.044	0.109	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
19	PDB:7mqaLQ	0.214	0.305	4.282E-12	830	0.058	0.083	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:6bk8D	0.210	0.654	6.763E-12	359	0.043	0.142	6bk8D.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RT67	0.0	1978	1274	0.791	0.744	DEND3_MOUSE DENN domain-containing protein 3 OS=Mus musculus OX=10090 GN=Dennd3 PE=1 SV=2
2	A2RUS2	0.0	2499	1198	1.000	1.000	DEND3_HUMAN DENN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=DENND3 PE=1 SV=2
3	Q8RXA7	1.72e-25	117	1187	0.078	0.078	SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana OX=3702 GN=SCD1 PE=1 SV=1
4	G3V7Q0	3.38e-17	90.1	1287	0.075	0.070	DEN5A_RAT DENN domain-containing protein 5A OS=Rattus norvegicus OX=10116 GN=Dennd5a PE=2 SV=1
5	Q6IQ26	3.46e-17	90.1	1287	0.069	0.064	DEN5A_HUMAN DENN domain-containing protein 5A OS=Homo sapiens OX=9606 GN=DENND5A PE=1 SV=2
6	Q6PAL8	3.61e-17	90.1	1287	0.075	0.070	DEN5A_MOUSE DENN domain-containing protein 5A OS=Mus musculus OX=10090 GN=Dennd5a PE=1 SV=1
7	Q5VZ89	7.75e-17	89.0	1909	0.080	0.050	DEN4C_HUMAN DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=3
8	E9PXF8	8.40e-17	89.0	1872	0.079	0.051	MTMRD_MOUSE Myotubularin-related protein 13 OS=Mus musculus OX=10090 GN=Sbf2 PE=1 SV=1
9	Q86WG5	1.32e-16	88.2	1849	0.080	0.052	MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens OX=9606 GN=SBF2 PE=1 SV=1
10	A2RSQ0	8.15e-16	85.5	1274	0.063	0.060	DEN5B_MOUSE DENN domain-containing protein 5B OS=Mus musculus OX=10090 GN=Dennd5b PE=1 SV=2
11	Q6ZUT9	9.91e-16	85.1	1274	0.064	0.060	DEN5B_HUMAN DENN domain-containing protein 5B OS=Homo sapiens OX=9606 GN=DENND5B PE=1 SV=2
12	O75064	2.17e-15	84.3	1496	0.085	0.068	DEN4B_HUMAN DENN domain-containing protein 4B OS=Homo sapiens OX=9606 GN=DENND4B PE=1 SV=4
13	P78524	9.30e-14	79.0	1137	0.082	0.086	DEN2B_HUMAN DENN domain-containing protein 2B OS=Homo sapiens OX=9606 GN=DENND2B PE=1 SV=3
14	A6H8H2	9.63e-14	79.0	1906	0.075	0.047	DEN4C_MOUSE DENN domain-containing protein 4C OS=Mus musculus OX=10090 GN=Dennd4c PE=1 SV=1
15	Q9W3D3	1.75e-13	78.2	1671	0.065	0.047	CRAG_DROME DENN domain-containing protein Crag OS=Drosophila melanogaster OX=7227 GN=Crag PE=1 SV=3
16	Q7Z401	2.45e-13	77.8	1863	0.077	0.049	MYCPP_HUMAN C-myc promoter-binding protein OS=Homo sapiens OX=9606 GN=DENND4A PE=1 SV=2
17	Q7KSP6	7.49e-13	75.9	1973	0.079	0.048	Q7KSP6_DROME SET domain binding factor, isoform B OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=1
18	Q9VGH9	9.59e-13	75.9	1993	0.079	0.048	Q9VGH9_DROME SET domain binding factor, isoform A OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=3
19	Q8K382	1.13e-12	75.1	1016	0.074	0.088	DEN1A_MOUSE DENN domain-containing protein 1A OS=Mus musculus OX=10090 GN=Dennd1a PE=1 SV=2
20	Q6P3S1	1.73e-12	74.3	775	0.079	0.123	DEN1B_HUMAN DENN domain-containing protein 1B OS=Homo sapiens OX=9606 GN=DENND1B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09794 Avl9	43	14.2	Transport protein Avl9
2	PF03455 dDENN	0.012	27.0	dDENN domain
3	PF02141 DENN	3.1e-45	165.9	DENN (AEX-3) domain
4	PF07494 Reg_prop	3.6e+02	12.8	Two component regulator propeller
5	PF07719 TPR_2	8.4e+02	11.6	Tetratricopeptide repeat
6	PF03456 uDENN	0.24	23.2	uDENN domain
7	PF00400 WD40	0.16	24.0	WD domain, G-beta repeat
8	PF19056 WD40_2	0.013	25.8	WD40 repeated domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262585

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331748	0.969	Ras-related protein Rab-12
2	9606.ENSP00000324560	0.918	Serine/threonine-protein kinase ULK1
3	9606.ENSP00000350386	0.900	Rab proteins geranylgeranyltransferase component A 1
4	9606.ENSP00000355511	0.900	Rab proteins geranylgeranyltransferase component A 2
5	9606.ENSP00000369538	0.900	Rab GDP dissociation inhibitor beta
6	9606.ENSP00000394071	0.900	Rab GDP dissociation inhibitor alpha
7	9606.ENSP00000246117	0.756	Nicalin
8	9606.ENSP00000299290	0.698	Protein TBATA
9	9606.ENSP00000373734	0.657	DENN domain-containing protein 5B
10	9606.ENSP00000328524	0.653	DENN domain-containing protein 5A
11	9606.ENSP00000356257	0.637	Leiomodin-1
12	9606.ENSP00000310788	0.573	Olfactory receptor 5J2
13	9606.ENSP00000433528	0.566	Suppression of tumorigenicity 5 protein
14	9606.ENSP00000305204	0.563	Cytoskeleton-associated protein 2-like
15	9606.ENSP00000351770	0.535	Forkhead-associated domain-containing protein 1
16	9606.ENSP00000362792	0.526	Olfactory receptor 1N2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0005488	0.871	binding
GO:0005515	0.802	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.982	cellular process
GO:0046907	0.925	intracellular transport
GO:0008152	0.887	metabolic process
GO:0071704	0.874	organic substance metabolic process
GO:0016192	0.871	vesicle-mediated transport
GO:0006807	0.848	nitrogen compound metabolic process
GO:0043170	0.827	macromolecule metabolic process
GO:0044238	0.780	primary metabolic process
GO:1901564	0.749	organonitrogen compound metabolic process
GO:0007034	0.689	vacuolar transport
GO:0007041	0.608	lysosomal transport
GO:0019538	0.499	protein metabolic process
GO:0008333	0.454	endosome to lysosome transport
GO:0009056	0.363	catabolic process
GO:0050789	0.359	regulation of biological process
GO:0050794	0.342	regulation of cellular process
GO:1901575	0.306	organic substance catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043226	0.855	organelle
GO:0043227	0.810	membrane-bounded organelle
GO:0043229	0.765	intracellular organelle
GO:0043231	0.762	intracellular membrane-bounded organelle
GO:0016020	0.682	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]