StarFunc result for job id A2VDJ0

User Input

>input (1609 residues)
MAGLRRPQPGCYCRTAAAVNLLLGVFQVLLPCCRPGGAQGQAIEPLPNVVELWQAEEGEL
LLPTQGDSEEGLEEPSQEQSFSDKLFSGKGLHFQPSVLDFGIQFLGHPVAKILHAYNPSR
DSEVVVNSVFAAAGHFHVPPVPCRVIPAMGKTSFRIIFLPTEEGSIESSLFINTSSYGVL
SYHVSGIGTRRISTEGSAKQLPNAYFLLPKVQSIQLSQMQAETTNTSLLQVQLECSLHNK
VCQQLKGCYLESDDVLRLQMSIMVTMENFSKEFEENTQHLLDHLSIVYVATDESETSDDS
AVNMYILHSGNSLIWIQDIRHFSQRDALSLQFEPVLLPTSTTNFTKIASFTCKATSCDSG
IIEDVKKTTHTPTLKACLFSSVAQGYFRMDSSATQFHIETHENTSGLWSIWYRNHFDRSV
VLNDVFLSKETKHMLKILNFTGPLFLPPGCWNIFSLKLAVKDIAINLFTNVFLTTNIGAI
FAIPLQIYSAPTKEGSLGFEVIAHCGMHYFMGKSKAGNPNWNGSLSLDQSTWNVDSELAN
KLYERWKKYKNGDVCKRNVLGTTRFAHLKKSKESESFVFFLPRLIAEPGLMLNFSATALR
SRMIKYFVVQNPSSWPVSLQLLPLSLYPKPEALVHLLHRWFGTDMQMINFTTGEFQLTEA
CPYLGTHSEESRFGILHLHLQPLEMKRVGVVFTPADYGKVTSLILIRNNLTVIDMIGVEG
FGARELLKVGGRLPGAGGSLRFKVPESTLMDCRRQLKDSKQILSITKNFKVENIGPLPIT
VSSLKINGYNCQGYGFEVLDCHQFSLDPNTSRDISIVFTPDFTSSWVIRDLSLVTAADLE
FRFTLNVTLPHHLLPLCADVVPGPSWEESFWRLTVFFVSLSLLGVILIAFQQAQYILMEF
MKTRQRQNASSSSQQNNGPMDVISPHSYKSNCKNFLDTYGPSDKGRGKNCLPVNTPQSRI
QNAAKRSPATYGHSQKKHKCSVYYSKHKTSTAAASSTSTTTEEKQTSPLGSSLPAAKEDI
CTDAMRENWISLRYASGINVNLQKNLTLPKNLLNKEENTLKNTIVFSNPSSECSMKEGIQ
TCMFPKETDIKTSENTAEFKERELCPLKTSKKLPENHLPRNSPQYHQPDLPEISRKNNGN
NQQVPVKNEVDHCENLKKVDTKPSSEKKIHKTSREDMFSEKQDIPFVEQEDPYRKKKLQE
KREGNLQNLNWSKSRTCRKNKKRGVAPVSRPPEQSDLKLVCSDFERSELSSDINVRSWCI
QESTREVCKADAEIASSLPAAQREAEGYYQKPEKKCVDKFCSDSSSDCGSSSGSVRASRG
SWGSWSSTSSSDGDKKPMVDAQHFLPAGDSVSQNDFPSEAPISLNLSHNICNPMTVNSLP
QYAEPSCPSLPAGPTGVEEDKGLYSPGDLWPTPPVCVTSSLNCTLENGVPCVIQESAPVH
NSFIDWSATCEGQFSSAYCPLELNDYNAFPEENMNYANGFPCPADVQTDFIDHNSQSTWN
TPPNMPAAWGHASFISSPPYLTSTRSLSPMSGLFGSIWAPQSDVYENCCPINPTTEHSTH
MENQAVVCKEYYPGFNPFRAYMNLDIWTTTANRNANFPLSRDSSYCGNV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2VDJ0	1.000	1.000	0.000	1609	1.000	1.000	A2VDJ0.pdb.gz	T131L_HUMAN Transmembrane protein 131-like OS=Homo sapiens OX=9606 GN=TMEM131L PE=1 SV=2
2	PDB:7sqcO0	0.106	0.146	3.856E-22	1140	0.064	0.090	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
3	AFDB:M9NE05	0.076	0.060	2.926E-11	2192	0.131	0.096	M9NE05.pdb.gz	M9NE05_DROME Neuromusculin, isoform E OS=Drosophila melanogaster OX=7227 GN=nrm PE=4 SV=1
4	AFDB:Q9VPZ7	0.070	0.080	5.906E-11	1342	0.098	0.117	Q9VPZ7.pdb.gz	Q9VPZ7_DROME LP22668p OS=Drosophila melanogaster OX=7227 GN=robo3 PE=2 SV=2
5	PDB:5a42A	0.072	0.073	8.219E-11	1597	0.057	0.058	5a42A.pdb.gz
6	PDB:7sqcO1	0.088	0.166	1.357E-10	673	0.021	0.049	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
7	PDB:7q1yA	0.078	0.086	2.740E-10	1374	0.052	0.060	7q1yA.pdb.gz
8	AFDB:Q9BZA8	0.066	0.076	3.418E-10	1340	0.109	0.131	Q9BZA8.pdb.gz	PC11Y_HUMAN Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1
9	AFDB:Q0E9F2	0.056	0.058	5.106E-10	1542	0.083	0.087	Q0E9F2.pdb.gz	Q0E9F2_DROME Sticks and stones, isoform B OS=Drosophila melanogaster OX=7227 GN=sns PE=1 SV=1
10	AFDB:O55005	0.068	0.067	1.539E-9	1651	0.115	0.112	O55005.pdb.gz	ROBO1_RAT Roundabout homolog 1 OS=Rattus norvegicus OX=10116 GN=Robo1 PE=1 SV=1
11	PDB:4rtdA	0.068	0.090	1.667E-9	1122	0.049	0.070	4rtdA.pdb.gz
12	AFDB:F1R2D2	0.065	0.063	1.882E-9	1687	0.122	0.116	F1R2D2.pdb.gz
13	AFDB:F1QRP2	0.097	0.127	2.542E-9	1135	0.083	0.118	F1QRP2.pdb.gz	F1QRP2_DANRE Protocadherin 18a OS=Danio rerio OX=7955 GN=id:ibd5114 PE=4 SV=2
14	AFDB:Q9VGW1	0.100	0.087	2.673E-9	1943	0.136	0.113	Q9VGW1.pdb.gz	CAD86_DROME Cadherin-86C OS=Drosophila melanogaster OX=7227 GN=Cad86C PE=2 SV=3
15	PDB:7uslA	0.085	0.128	3.720E-9	856	0.050	0.093	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
16	AFDB:Q967D7	0.059	0.060	4.880E-9	1531	0.099	0.104	Q967D7.pdb.gz	TUTL_DROME Protein turtle OS=Drosophila melanogaster OX=7227 GN=tutl PE=1 SV=2
17	PDB:4lnvA	0.063	0.074	1.122E-8	1276	0.040	0.051	4lnvA.pdb.gz
18	PDB:4nenA	0.071	0.091	1.240E-8	1063	0.049	0.074	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
19	PDB:4ziqA	0.066	0.071	3.216E-8	1450	0.050	0.055	4ziqA.pdb.gz
20	PDB:4aq1A	0.068	0.130	5.052E-8	721	0.031	0.069	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2VDJ0	0.0	3353	1609	1.000	1.000	T131L_HUMAN Transmembrane protein 131-like OS=Homo sapiens OX=9606 GN=TMEM131L PE=1 SV=2
2	Q18264	5.92e-33	142	1831	0.077	0.068	Q18264_CAEEL TMEM131_like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tmem-131 PE=1 SV=4
3	Q9V7H4	1.06e-23	112	1567	0.040	0.041	TM131_DROME Transmembrane protein 131 homolog OS=Drosophila melanogaster OX=7227 GN=CG8370 PE=1 SV=2
4	Q9U740	0.14	39.3	616	0.020	0.052	Q9U740_DROME Liquid facets (Fragment) OS=Drosophila melanogaster OX=7227 GN=lqf PE=2 SV=1
5	A8JNM3	0.18	38.9	640	0.020	0.050	A8JNM3_DROME Liquid facets, isoform F OS=Drosophila melanogaster OX=7227 GN=lqf PE=1 SV=1
6	M9PBU6	0.18	38.9	637	0.020	0.050	M9PBU6_DROME Liquid facets, isoform I OS=Drosophila melanogaster OX=7227 GN=lqf PE=1 SV=1
7	M9PEM7	0.18	38.9	630	0.020	0.051	M9PEM7_DROME Liquid facets, isoform G OS=Drosophila melanogaster OX=7227 GN=lqf PE=1 SV=1
8	Q7KU93	0.21	38.9	784	0.020	0.041	Q7KU93_DROME Liquid facets, isoform C OS=Drosophila melanogaster OX=7227 GN=lqf PE=1 SV=1
9	Q9VS85	0.21	38.9	831	0.020	0.039	Q9VS85_DROME FI19443p1 OS=Drosophila melanogaster OX=7227 GN=lqf PE=1 SV=3
10	M9PEF2	0.22	38.5	791	0.020	0.040	M9PEF2_DROME Liquid facets, isoform J OS=Drosophila melanogaster OX=7227 GN=lqf PE=1 SV=1
11	Q7KU90	0.22	38.5	824	0.020	0.039	Q7KU90_DROME Liquid facets, isoform B OS=Drosophila melanogaster OX=7227 GN=lqf PE=1 SV=1
12	Q9U741	0.22	38.5	784	0.020	0.041	Q9U741_DROME Liquid facets OS=Drosophila melanogaster OX=7227 GN=lqf PE=2 SV=1
13	P34574	0.36	38.1	1681	0.018	0.017	CLH_CAEEL Probable clathrin heavy chain 1 OS=Caenorhabditis elegans OX=6239 GN=chc-1 PE=1 SV=1
14	Q9UK20	1.4	34.7	162	0.014	0.136	Q9UK20_HUMAN Ezrin (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=2
15	P93836	1.9	35.4	445	0.017	0.063	HPPD_ARATH 4-hydroxyphenylpyruvate dioxygenase OS=Arabidopsis thaliana OX=3702 GN=HPD PE=1 SV=2
16	Q80ZB2	2.8	35.0	2201	0.019	0.014	Q80ZB2_RAT ATP-binding cassette 1 OS=Rattus norvegicus OX=10116 GN=Abca1 PE=2 SV=1
17	A0A8I6ATT1	3.0	35.0	2190	0.019	0.014	A0A8I6ATT1_RAT ATP binding cassette subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Abca1 PE=1 SV=1
18	F1LNL3	3.0	35.0	2201	0.019	0.014	F1LNL3_RAT ATP binding cassette subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Abca1 PE=1 SV=4
19	A0A8I5ZLK5	3.4	35.0	2263	0.019	0.014	A0A8I5ZLK5_RAT ATP binding cassette subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Abca1 PE=1 SV=1
20	Q8RWD9	3.6	34.7	648	0.019	0.046	ACBP5_ARATH Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana OX=3702 GN=ACBP5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15780 ASH	1.1e-05	36.8	Abnormal spindle-like microcephaly-assoc'd, ASPM-SPD-2-Hydin
2	PF19532 TMEM131_like	0	2544.8	Transmembrane protein 131-like
3	PF12371 TMEM131_like_N	2.2e-15	68.0	Transmembrane protein 131-like N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000386787

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000350050	0.851	Transmembrane protein 229B
2	9606.ENSP00000423014	0.772	OCIA domain containing 2
3	9606.ENSP00000425840	0.760	Ring finger protein 150
4	9606.ENSP00000395083	0.751	Arfaptin-1
5	9606.ENSP00000441126	0.746	NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial
6	9606.ENSP00000261434	0.734	Lipoyl synthase, mitochondrial
7	9606.ENSP00000306015	0.724	Synaptopodin-2
8	9606.ENSP00000354830	0.724	DNA damage-inducible transcript 4-like protein
9	9606.ENSP00000370984	0.719	COMM domain-containing protein 8
10	9606.ENSP00000426638	0.719	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
11	9606.ENSP00000295454	0.714	Gamma-aminobutyric acid receptor subunit beta-1
12	9606.ENSP00000355162	0.714	Tigger transposable element-derived protein 4
13	9606.ENSP00000386918	0.702	ER lumen protein-retaining receptor 3
14	9606.ENSP00000478754	0.702	Probable ATP-dependent RNA helicase DDX6
15	9606.ENSP00000354652	0.695	Neuropeptide Y receptor type 1
16	9606.ENSP00000453293	0.689	Amyloid-beta A4 precursor protein-binding family A member 2
17	9606.ENSP00000296509	0.688	Mitotic spindle assembly checkpoint protein MAD2A
18	9606.ENSP00000364864	0.624	Kinesin-like protein KIF3B
19	9606.ENSP00000265512	0.607	Alcohol dehydrogenase 4, pi polypeptide
20	9606.ENSP00000372335	0.605	Negative elongation factor A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.980	biological regulation
GO:0050789	0.969	regulation of biological process
GO:0048523	0.961	negative regulation of cellular process
GO:1903037	0.805	regulation of leukocyte cell-cell adhesion
GO:0022408	0.805	negative regulation of cell-cell adhesion
GO:0051250	0.805	negative regulation of lymphocyte activation
GO:1902105	0.799	regulation of leukocyte differentiation
GO:0042129	0.799	regulation of T cell proliferation
GO:0050868	0.799	negative regulation of T cell activation
GO:0050672	0.798	negative regulation of lymphocyte proliferation
GO:0051093	0.775	negative regulation of developmental process
GO:0009966	0.762	regulation of signal transduction
GO:0048585	0.729	negative regulation of response to stimulus
GO:0045580	0.623	regulation of T cell differentiation
GO:1902106	0.623	negative regulation of leukocyte differentiation
GO:0042130	0.622	negative regulation of T cell proliferation
GO:0045581	0.609	negative regulation of T cell differentiation
GO:0030178	0.607	negative regulation of Wnt signaling pathway
GO:0060828	0.575	regulation of canonical Wnt signaling pathway
GO:0090090	0.570	negative regulation of canonical Wnt signaling pathway
GO:0009987	0.316	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0043231	0.955	intracellular membrane-bounded organelle
GO:0012505	0.493	endomembrane system
GO:0031090	0.365	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]