StarFunc result for job id A2VEC9

User Input

>input (1400 residues)
MLLPALLFGMAWALADGRWCEWTETIRVEEEVAPRQEDLVPCASLDHYSRLGWRLDLPWS
GRSGLTRSPAPGLCPIYKPPETRPAKWNRTVRTCCPGWGGAHCTEALAKASPEGHCFAMW
QCQLQAGSANASAGSLEECCARPWGQSWWDGSSQACRSCSSRHLPGSASSPALLQPLAGA
VGQLWSQHQRPSATCASWSGFHYRTFDGRHYHFLGRCTYLLAGAADSTWAVHLTPGDRCP
QPGHCQRVTMGPEEVLIQAGNVSVKGQLVPEGQSWLLHGLSLQWLGDWLVLSGGLGVVVR
LDRTGSISISVDHELWGQTQGLCGLYNGWPEDDFMEPGGGLAMLAATFGNSWRLPGSESG
CLDAVEVAQGCDSPLGLIDADVEPGHLRAEAQDVCHQLLEGPFGQCHAQVSPAEYHEACL
FAYCAGAMAGSGQEGRQQAVCATFASYVQACARRHIHIRWRKPGFCERLCPGGQLYSDCV
SLCPPSCEAVGQGEEESCREECVSGCECPRGLFWNGTLCVPAAHCPCYYCRQRYVPGDTV
RQLCNPCVCRDGRWHCAQALCPAECAVGGDGHYLTFDGRSYSFWGGQGCRYSLVQDYVKG
QLLILLEHGACDAGSCLHAISVSLEDTHIQLRDSGAVLVNGQDVGLPWIGAEGLSVRRAS
SAFLLLRWPGAQVLWGLSDPVAYITLDPRHAHQVQGLCGTFTQNQQDDFLTPAGDVETSI
AAFASKFQVAGKGRCPSEDSALLSPCTTHSQRHAFAEAACAILHSSVFQECHRLVDKEPF
YLRCLAAVCGCDPGSDCLCPVLSAYARRCAQEGASPPWRNQTLCPVMCPGGQEYRECAPA
CGQHCGKPEDCGELGSCVAGCNCPLGLLWDPEGQCVPPSLCPCQLGARRYAPGSATMKEC
NRCICQERGLWNCTARHCPSQAFCPRELVYAPGACLLTCDSPSANHSCPAGSTDGCVCPP
GTVLLDERCVPPDLCPCRHSGQWYLPNATIQEDCNVCVCRGRQWHCTGQRRSGRCQASGA
PHYVTFDGLAFTYPGACEYLLVREASGLFTVSAQNLPCGASGLTCTKALAVRLEGTVVHM
LRGRAVTVNGVSVTPPKVYTGPGLSLRRAGLFLLLSTHLGLTLLWDGGTRVLVQLSPQFR
GRVAGLCGDFDGDASNDLRSRQGVLEPTAELAAHSWRLSPLCPEPGDLPHPCTMNTHRAG
WARARCGALLQPLFTLCHAEVPPQQHYEWCLYDACGCDSGGDCECLCSAIATYADECARH
GHHVRWRSQELCSLQCEGGQVYEACGPTCPPTCHEQHPEPGWHCQVVACVEGCFCPEGTL
LHGGACLEPASCPCEWGRNSFPPGSVLQKDCGNCTCQEGQWHCGGDGGHCEELVPACAEG
EALCQENGHCVPHGWLCDNQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q98UI9	0.709	0.484	1.465E-93	2108	0.244	0.162	Q98UI9.pdb.gz	MUC5B_CHICK Mucin-5B OS=Gallus gallus OX=9031 GN=MUC5B PE=1 SV=1
2	AFDB:Q6W4X9	0.687	0.406	1.042E-90	2439	0.253	0.145	Q6W4X9.pdb.gz	MUC6_HUMAN Mucin-6 OS=Homo sapiens OX=9606 GN=MUC6 PE=1 SV=3
3	AFDB:Q80Z19	0.428	0.233	6.712E-89	2680	0.257	0.134	Q80Z19.pdb.gz	MUC2_MOUSE Mucin-2 OS=Mus musculus OX=10090 GN=Muc2 PE=1 SV=3
4	AFDB:A0A0G2K1Y4	0.662	0.829	3.384E-87	1103	0.246	0.313	A0A0G2K1Y4.pdb.gz	A0A0G2K1Y4_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
5	AFDB:F1NBL0	0.665	0.779	6.418E-83	1185	0.219	0.258	F1NBL0.pdb.gz	MUC6_CHICK Mucin-6 (Fragment) OS=Gallus gallus OX=9031 GN=MUC6 PE=1 SV=1
6	AFDB:Q3ZCN5	0.414	0.260	1.156E-82	2332	0.255	0.153	Q3ZCN5.pdb.gz	OTOGL_HUMAN Otogelin-like protein OS=Homo sapiens OX=9606 GN=OTOGL PE=1 SV=6
7	AFDB:A0A286YAF1	0.371	0.255	3.746E-82	2146	0.255	0.166	A0A286YAF1.pdb.gz
8	AFDB:Q28983	0.233	0.146	3.590E-73	2476	0.241	0.137	Q28983.pdb.gz	ZAN_PIG Zonadhesin OS=Sus scrofa OX=9823 GN=ZAN PE=1 SV=1
9	AFDB:E9Q0B5	0.225	0.126	1.726E-69	2583	0.246	0.133	E9Q0B5.pdb.gz	E9Q0B5_MOUSE Fc fragment of IgG binding protein OS=Mus musculus OX=10090 GN=Fcgbp PE=1 SV=1
10	AFDB:O08523	0.209	0.142	1.167E-68	2155	0.212	0.138	O08523.pdb.gz	TECTA_MOUSE Alpha-tectorin OS=Mus musculus OX=10090 GN=Tecta PE=1 SV=2
11	PDB:6z3mc	0.079	0.591	7.575E-4	158	0.014	0.127	6z3mc.pdb.gz	Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.
12	PDB:6xt9A	0.043	0.072	2.228E-2	567	0.040	0.099	6xt9A.pdb.gz
13	PDB:1xi4A	0.044	0.041	6.235E-2	1630	0.021	0.018	1xi4A.pdb.gz
14	PDB:3jb9U	0.047	0.114	1.238E-1	430	0.011	0.037	3jb9U.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
15	PDB:7d5sB2	0.061	0.083	1.238E-1	851	0.066	0.109	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
16	PDB:3sfzA	0.063	0.060	1.366E-1	1133	0.064	0.079	3sfzA.pdb.gz	Crystal structure of full-length Apaf-1: how the death signal is relayed in the mitochondrial pathway of apoptosis.
17	PDB:2w7qA	0.033	0.159	1.506E-1	192	0.013	0.094	2w7qA.pdb.gz
18	PDB:5o9zL	0.044	0.102	1.506E-1	459	0.027	0.083	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
19	PDB:7qdrC	0.042	0.137	1.582E-1	305	0.015	0.069	7qdrC.pdb.gz
20	PDB:6nd4H	0.056	0.078	1.833E-1	834	0.037	0.062	6nd4H.pdb.gz	Conformational switches control early maturation of the eukaryotic small ribosomal subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2VEC9	0.0	2794	5150	1.000	0.272	SSPO_HUMAN SCO-spondin OS=Homo sapiens OX=9606 GN=SSPOP PE=2 SV=2
2	Q8CG65	0.0	1743	4998	0.627	0.176	SSPO_MOUSE SCO-spondin OS=Mus musculus OX=10090 GN=Sspo PE=2 SV=2
3	E7F9Z1	2.11e-179	594	2812	0.294	0.146	E7F9Z1_DANRE von Willebrand factor OS=Danio rerio OX=7955 GN=VWF PE=1 SV=3
4	Q8CIZ8	5.28e-165	552	2813	0.282	0.140	VWF_MOUSE von Willebrand factor OS=Mus musculus OX=10090 GN=Vwf PE=1 SV=2
5	P04275	3.25e-164	550	2813	0.281	0.140	VWF_HUMAN von Willebrand factor OS=Homo sapiens OX=9606 GN=VWF PE=1 SV=4
6	Q9ESP3	4.49e-159	527	1851	0.276	0.209	Q9ESP3_RAT Mucin (Fragment) OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=2 SV=1
7	Q8BYW0	7.28e-159	520	1477	0.259	0.245	Q8BYW0_MOUSE VWFD domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
8	Q9HC84	1.06e-158	534	5762	0.276	0.067	MUC5B_HUMAN Mucin-5B OS=Homo sapiens OX=9606 GN=MUC5B PE=1 SV=3
9	P98088	1.17e-158	534	5654	0.286	0.071	MUC5A_HUMAN Mucin-5AC OS=Homo sapiens OX=9606 GN=MUC5AC PE=1 SV=4
10	Q62635	1.03e-156	514	1513	0.268	0.248	MUC2_RAT Mucin-2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Muc2 PE=1 SV=1
11	E9QAQ8	1.53e-156	528	3455	0.273	0.111	E9QAQ8_MOUSE Mucin 5, subtypes A and C, tracheobronchial/gastric OS=Mus musculus OX=10090 GN=Muc5ac PE=1 SV=5
12	A0A0G2K1Y4	3.68e-156	526	3586	0.276	0.108	A0A0G2K1Y4_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
13	A0A0G2K8X5	6.56e-156	526	3922	0.276	0.099	A0A0G2K8X5_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
14	M9PCE5	1.37e-155	525	3842	0.279	0.102	M9PCE5_DROME Hemolectin, isoform B OS=Drosophila melanogaster OX=7227 GN=Hml PE=1 SV=1
15	Q9VU94	2.13e-155	524	3843	0.279	0.102	Q9VU94_DROME Hemolectin, isoform A OS=Drosophila melanogaster OX=7227 GN=Hml PE=1 SV=2
16	Q9U5D0	2.17e-155	524	3843	0.279	0.102	Q9U5D0_DROME Hemolectin OS=Drosophila melanogaster OX=7227 GN=Hml PE=2 SV=1
17	E9PWB6	2.25e-154	521	2751	0.271	0.138	E9PWB6_MOUSE Mucin 5, subtypes A and C, tracheobronchial/gastric OS=Mus musculus OX=10090 GN=Muc5ac PE=1 SV=1
18	E9Q5I3	2.62e-153	518	4800	0.259	0.075	E9Q5I3_MOUSE Mucin 5, subtype B, tracheobronchial OS=Mus musculus OX=10090 GN=Muc5b PE=1 SV=1
19	Q8K1G6	3.36e-153	518	4782	0.260	0.076	Q8K1G6_MOUSE Muc5b protein OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
20	Q80Z19	6.42e-152	513	2680	0.266	0.139	MUC2_MOUSE Mucin-2 OS=Mus musculus OX=10090 GN=Muc2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08742 C8	1.4e-44	161.5	C8 domain
2	PF05375 Pacifastin_I	7e-08	43.4	Pacifastin inhibitor (LCMII)
3	PF01826 TIL	4.5e-22	89.3	Trypsin Inhibitor like cysteine rich domain
4	PF00094 VWD	2.5e-78	273.3	von Willebrand factor type D domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008967058.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003832328.1	0.868	Extracellular matrix protein FRAS1 isoform X1
2	9597.XP_003818630.1	0.859	Thrombospondin type-1 domain-containing protein 4
3	9597.XP_003822656.1	0.859	ADAMTS-like protein 1
4	9597.XP_008968716.1	0.859	ADAMTS-like protein 4
5	9597.XP_003827475.1	0.822	A disintegrin and metalloproteinase with thrombospondin motifs 6
6	9597.XP_003811005.1	0.806	EGF like, fibronectin type III and laminin G domains
7	9597.XP_003833315.1	0.789	Belongs to the protein kinase superfamily. Tyr protein kinase family
8	9597.XP_008966737.1	0.776	Titin
9	9597.XP_008975771.1	0.765	Protein O-fucosyltransferase 2
10	9597.XP_008961941.1	0.764	Spondin 2
11	9597.XP_003825774.1	0.762	Leucine-rich repeat serine/threonine-protein kinase 2
12	9597.XP_008969331.1	0.762	Cartilage oligomeric matrix protein
13	9597.XP_003817481.1	0.754	WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 2 isoform X1
14	9597.XP_008959201.1	0.754	WAP, follistatin/kazal, immunoglobulin, kunitz and netrin domain containing 1
15	9597.XP_008976110.1	0.753	Papilin, proteoglycan like sulfated glycoprotein
16	9597.XP_003828481.1	0.728	Leucine rich repeat kinase 1
17	9597.XP_003825046.2	0.721	Thrombospondin type 1 domain containing 7A
18	9597.XP_003818233.2	0.720	Spondin-1
19	9597.XP_003815091.1	0.714	Leucine-rich repeat-containing protein 61
20	9597.XP_003807498.1	0.711	Thrombospondin type-1 domain-containing protein 1 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.360	multicellular organismal process
GO:0065007	0.332	biological regulation
GO:0009987	0.317	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.998	cellular anatomical entity
GO:0005576	0.970	extracellular region
GO:0005615	0.892	extracellular space
GO:0071944	0.850	cell periphery
GO:0005737	0.509	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]