StarFunc result for job id A3KMH1

User Input

>input (1905 residues)
MQSRLLLLGAPGGHGGPASRRMRLLLRQVVQRRPGGDRQRPEVRLLHAGSGADTGDTVNI
GDVSYKLKIPKNPELVPQNYISDSLAQSVVQHLRWIMQKDLLGQDVFLIGPPGPLRRSIA
MQYLELTKREVEYIALSRDTTETDLKQRREIRAGTAFYIDQCAVRAATEGRTLILEGLEK
AERNVLPVLNNLLENREMQLEDGRFLMSAERYDKLLRDHTKKELDSWKIVRVSENFRVIA
LGLPVPRYSGNPLDPPLRSRFQARDIYYLPFKDQLKLLYSIGANVSAEKVSQLLSFATTL
CSQESSTLGLPDFPLDSLAAAVQILDSFPMMPIKHAIQWLYPYSILLGHEGKMAVEGVLK
RFELQDSGSSLLPKEIVKVEKMMENHVSQASVTIRIADKEVTIKVPAGTRLLSQPCASDR
FIQTLSHKQLQAEMMQSHMVKDICLIGGKGCGKTVIAKNFADTLGYNIEPIMLYQDMTAR
DLLQQRYTLPNGDTAWRSSPLVNAALEGKLVLLDGIHRVNAGTLAVLQRLIHDRELSLYD
GSRLLREDRYMRLKEELQLSDEQLQKRSIFPIHPSFRIIALAEPPVIGSTAHQWLGPEFL
TMFFFHYMKPLVKSEEIQVIKEKVPNVPQEALDKLLSFTHKLRETQDPTAQSLAASLSTR
QLLRISRRLSQYPNENLHSAVTKACLSRFLPSLARSALEKNLADATIEINTDDNLEPELK
DYKCEVTSGTLRIGAVSAPIYNAHEKMKVPDVLFYDNIQHVIVMEDMLKDFLLGEHLLLV
GNQGVGKNKIVDRFLHLLNRPREYIQLHRDTTVQTLTLQPSVKDGLIVYEDSPLVKAVKL
GHILVVDEADKAPTNVTCILKTLVENGEMILADGRRIVANSANVNGRENVVVIHPDFRMI
VLANRPGFPFLGNDFFGTLGDIFSCHAVDNPKPHSELEMLRQYGPNVPEPILQKLVAAFG
ELRSLADQGIINYPYSTREVVNIVKHLQKFPTEGLSSVVRNVFDFDSYNNDMREILINTL
HKYGIPIGAKPTSVQLAKELTLPEQTFMGYWTIGQARSGMQKLLCPVETHHIDIKGPALI
NIQEYPIERHEERSLNFTEECASWRIPLDEINIICDIATSHENEQNTLYVVTCNPASLYF
MNMTGKSGFFVDFFDIFPRTANGVWHPFVTVAPLGSPLKGQVVLHEQQSNVILLLDTTGR
ALHRLILPSEKFTSKKPFWWNKEEAETYKMCKEFSHKNWLVFYKEKGNSLTVLDVLEGRT
HTISLPINLKTVFLVAEDKWLLVESKTNQKYLLTKPAHIESEGSGVCQLYVLKEEPPSTG
FGVTQETEFSIPHKISSDQLSSEHLSSAVEQKIASPNRILSDEKNYATIVVGFPDLMSPS
EVYSWKRPSSLHKRSGTDTSFYRGKKKRGTPKQSNCVTLLDTNQVVRILPPGEVPLKDIY
PKDVTPPQTSGYIEVTDLQSKKLRYIPIPRSESLSPYTTWLSTISDTDALLAEWDKSGVV
TVDMGGHIRLWETGLERLQRSLMEWRNMIGQDDRNMQITINRDSGEDVSSPKHGKEDPDN
MPHVGGNTWAGGTGGRDTAGLGGKGGPYRLDAGHTVYQVSQAEKDAVPEEVKRAAREMGQ
RAFQQRLKEIQMSEYDAATYERFSGAVRRQVHSLRIILDNLQAKGKERQWLRHQATGELD
DAKIIDGLTGEKAIYKRRGELEPQLGSPQQKPKRLRLVVDVSGSMYRFNRMDGRLERTME
AVCMVMEAFENYEEKFQYDIVGHSGDGYNIGLVPMNKIPKDNKQRLEILKTMHAHSQFCM
SGDHTLEGTEHAIKEIVKEEADEYFVIVLSDANLSRYGIHPAKFAQILTRDPQVNAFAIF
IGSLGDQATRLQRTLPAGRSFVAMDTKDIPQILQQIFTSTMLSSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A3KMH1	1.000	1.000	0.000	1905	1.000	1.000	A3KMH1.pdb.gz	VWA8_HUMAN von Willebrand factor A domain-containing protein 8 OS=Homo sapiens OX=9606 GN=VWA8 PE=1 SV=2
2	AFDB:Q57ZW5	0.509	0.457	0.000	2163	0.324	0.285	Q57ZW5.pdb.gz	Q57ZW5_TRYB2 VWFA domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.300 PE=4 SV=1
3	AFDB:Q8CC88	0.960	0.960	0.000	1905	0.861	0.861	Q8CC88.pdb.gz	VWA8_MOUSE von Willebrand factor A domain-containing protein 8 OS=Mus musculus OX=10090 GN=Vwa8 PE=1 SV=2
4	PDB:7mi6A	0.307	0.250	5.008E-27	2419	0.077	0.061	7mi6A.pdb.gz	Targeting allostery in the Dynein motor domain with small molecule inhibitors.
5	AFDB:E7FFM4	0.325	0.237	1.024E-24	2685	0.076	0.054	E7FFM4.pdb.gz
6	PDB:4w8fB	0.306	0.234	1.945E-24	2609	0.072	0.053	4w8fB.pdb.gz	Allosteric communication in the Dynein motor domain.
7	PDB:7z8gA	0.309	0.207	1.708E-23	3047	0.078	0.049	7z8gA.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
8	PDB:5nugA	0.311	0.213	2.090E-23	2920	0.074	0.048	5nugA.pdb.gz	Cryo-EM Reveals How Human Cytoplasmic Dynein Is Auto-inhibited and Activated.
9	PDB:7z8fe	0.310	0.146	4.691E-23	4579	0.080	0.033	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
10	PDB:6i26A	0.326	0.185	1.289E-22	3587	0.087	0.046	6i26A.pdb.gz
11	PDB:6i27A	0.299	0.174	3.200E-22	3544	0.090	0.048	6i27A.pdb.gz
12	PDB:6ylfAP1	0.267	0.150	4.657E-21	3629	0.089	0.047	6ylfAP1.pdb.gz
13	PDB:6or5A	0.325	0.303	4.301E-20	2058	0.082	0.076	6or5A.pdb.gz	Structural Insights into Mdn1, an Essential AAA Protein Required for Ribosome Biogenesis.
14	PDB:5jcss	0.254	0.244	1.958E-19	2003	0.076	0.072	5jcss.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
15	AFDB:P37571	0.088	0.190	1.001E-11	810	0.051	0.121	P37571.pdb.gz	CLPC_BACSU Negative regulator of genetic competence ClpC/MecB OS=Bacillus subtilis (strain 168) OX=224308 GN=clpC PE=1 SV=1
16	AFDB:Q5BL07	0.077	0.108	4.333E-11	1284	0.055	0.081	Q5BL07.pdb.gz	PEX1_MOUSE Peroxisomal ATPase PEX1 OS=Mus musculus OX=10090 GN=Pex1 PE=1 SV=2
17	AFDB:Q8DVD0	0.087	0.201	5.868E-11	753	0.048	0.122	Q8DVD0.pdb.gz	Q8DVD0_STRMU ATP-dependent protease ClpE OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=clpE PE=3 SV=1
18	AFDB:Q6H795	0.082	0.153	7.946E-11	938	0.067	0.135	Q6H795.pdb.gz	CLPD1_ORYSJ Chaperone protein ClpD1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=CLPD1 PE=2 SV=1
19	AFDB:Q2G0P5	0.082	0.174	1.076E-10	818	0.050	0.116	Q2G0P5.pdb.gz	CLPC_STAA8 ATP-dependent Clp protease ATP-binding subunit ClpC OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=clpC PE=1 SV=1
20	AFDB:P42762	0.087	0.158	2.810E-10	945	0.058	0.116	P42762.pdb.gz	CLPD_ARATH Chaperone protein ClpD, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPD PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A3KMH1	0.0	3949	1905	1.000	1.000	VWA8_HUMAN von Willebrand factor A domain-containing protein 8 OS=Homo sapiens OX=9606 GN=VWA8 PE=1 SV=2
2	Q8CC88	0.0	3451	1905	0.862	0.862	VWA8_MOUSE von Willebrand factor A domain-containing protein 8 OS=Mus musculus OX=10090 GN=Vwa8 PE=1 SV=2
3	Q57ZW5	6.52e-79	293	2163	0.090	0.079	Q57ZW5_TRYB2 VWFA domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.300 PE=4 SV=1
4	Q4GZD0	7.65e-08	60.5	4600	0.060	0.025	Q4GZD0_TRYB2 Midasin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.880 PE=3 SV=1
5	Q9NU22	1.10e-07	60.1	5596	0.087	0.030	MDN1_HUMAN Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2
6	Q6FIU8	1.99e-06	55.8	4880	0.061	0.024	Q6FIU8_CANGA Midasin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0M11616g PE=3 SV=1
7	O94248	2.73e-06	55.5	4717	0.059	0.024	MDN1_SCHPO Midasin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mdn1 PE=1 SV=1
8	A0A1P8AUY4	6.24e-05	50.8	5400	0.028	0.010	MDN1_ARATH Midasin OS=Arabidopsis thaliana OX=3702 GN=MDN1 PE=1 SV=1
9	Q12019	0.002	45.8	4910	0.050	0.019	MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDN1 PE=1 SV=1
10	O53314	0.074	40.0	320	0.015	0.091	O53314_MYCTU Probable methanol dehydrogenase transcriptional regulatory protein MoxR3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=moxR3 PE=1 SV=1
11	P38650	1.1	37.0	4644	0.018	0.007	DYHC1_RAT Cytoplasmic dynein 1 heavy chain 1 OS=Rattus norvegicus OX=10116 GN=Dync1h1 PE=1 SV=1
12	Q14204	1.1	37.0	4646	0.018	0.007	DYHC1_HUMAN Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5
13	Q2LEK1	1.2	36.6	4643	0.018	0.007	Q2LEK1_DANRE Cytoplasmic dynein 1 heavy chain 1 OS=Danio rerio OX=7955 GN=fk70a07 PE=1 SV=1
14	Q9JHU4	1.2	36.6	4644	0.018	0.007	DYHC1_MOUSE Cytoplasmic dynein 1 heavy chain 1 OS=Mus musculus OX=10090 GN=Dync1h1 PE=1 SV=2
15	Q5PQ53	2.6	34.7	283	0.016	0.110	PEF1_XENLA Peflin OS=Xenopus laevis OX=8355 GN=pef1 PE=1 SV=1
16	E9PRF7	3.6	32.7	114	0.010	0.175	E9PRF7_HUMAN RAB30, member RAS oncogene family (Fragment) OS=Homo sapiens OX=9606 GN=RAB30 PE=1 SV=1
17	M9NCR4	3.8	35.0	15105	0.023	0.003	M9NCR4_DROME Dumpy, isoform J OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	M9NER8	3.8	35.0	15638	0.023	0.003	M9NER8_DROME Dumpy, isoform I OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
19	M9PCJ8	3.8	35.0	14825	0.023	0.003	M9PCJ8_DROME Dumpy, isoform X OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	M9PB30	3.9	35.0	22949	0.023	0.002	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	0.22	23.4	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	0.0039	28.6	AAA domain
3	PF13191 AAA_16	0.016	27.1	AAA ATPase domain
4	PF13238 AAA_18	2.1e+02	13.9	AAA domain
5	PF07724 AAA_2	1.1e+02	14.3	AAA domain (Cdc48 subfamily)
6	PF13401 AAA_22	0.16	23.7	AAA domain
7	PF13521 AAA_28	31	16.2	AAA domain
8	PF07726 AAA_3	0.11	23.8	ATPase family associated with various cellular activities (AAA)
9	PF07728 AAA_5	1.4e-98	337.8	AAA domain (dynein-related subfamily)
10	PF12775 AAA_7	0.3	22.1	P-loop containing dynein motor region
11	PF00005 ABC_tran	1.8e+02	14.1	ABC transporter
12	PF00006 ATP-synt_ab	6.1e+02	11.5	ATP synthase alpha/beta family, nucleotide-binding domain
13	PF08406 CbbQ_C	0.019	26.6	CbbQ/NirQ/NorQ C-terminal
14	PF05335 DUF745	2.2e+02	13.0	Protein of unknown function (DUF745)
15	PF01078 Mg_chelatase	60	14.5	Magnesium chelatase, subunit ChlI
16	PF00910 RNA_helicase	4.3e+02	12.7	RNA helicase
17	PF08477 Roc	19	16.9	Ras of Complex, Roc, domain of DAPkinase
18	PF14532 Sigma54_activ_2	1.8	20.1	Sigma-54 interaction domain
19	PF05621 TniB	8.2	17.3	Bacterial TniB protein
20	PF02367 TsaE	80	14.6	Threonylcarbamoyl adenosine biosynthesis protein TsaE

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368612

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348596	0.877	Protein SDA1 homolog
2	9606.ENSP00000413572	0.854	Notchless protein homolog 1
3	9606.ENSP00000362153	0.817	Nucleolar GTP-binding protein 2
4	9606.ENSP00000368793	0.774	Peptide chain release factor 1, mitochondrial
5	9606.ENSP00000364037	0.769	Testis-expressed protein 10
6	9606.ENSP00000368716	0.754	N-alpha-acetyltransferase 16, NatA auxiliary subunit
7	9606.ENSP00000259953	0.739	Nurim
8	9606.ENSP00000460348	0.729	Pre-mRNA-processing-splicing factor 8
9	9606.ENSP00000440190	0.726	Tudor domain-containing protein 3
10	9606.ENSP00000354040	0.715	Nucleolar GTP-binding protein 1
11	9606.ENSP00000476117	0.713	WD repeat-containing protein 18
12	9606.ENSP00000346725	0.710	Pescadillo homolog
13	9606.ENSP00000358812	0.705	Protein RRP5 homolog
14	9606.ENSP00000429367	0.681	Protein FAM92A
15	9606.ENSP00000338573	0.679	Guanine nucleotide-binding protein-like 3-like protein
16	9606.ENSP00000395772	0.679	Guanine nucleotide-binding protein-like 3
17	9606.ENSP00000302886	0.675	Proliferation-associated protein 2G4
18	9606.ENSP00000449770	0.675	Uncharacterized protein
19	9606.ENSP00000363384	0.672	Zinc finger protein 593
20	9606.ENSP00000355541	0.665	HEAT repeat-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016887	0.989	ATP hydrolysis activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071840	0.984	cellular component organization or biogenesis
GO:0044085	0.964	cellular component biogenesis
GO:0022613	0.950	ribonucleoprotein complex biogenesis
GO:0016043	0.849	cellular component organization
GO:0042254	0.634	ribosome biogenesis
GO:0022607	0.595	cellular component assembly
GO:0065003	0.549	protein-containing complex assembly
GO:0008152	0.540	metabolic process
GO:0050789	0.513	regulation of biological process
GO:0044237	0.469	cellular metabolic process
GO:0071704	0.447	organic substance metabolic process
GO:0071826	0.385	ribonucleoprotein complex subunit organization
GO:0022618	0.350	ribonucleoprotein complex assembly
GO:0044238	0.345	primary metabolic process
GO:0050794	0.338	regulation of cellular process
GO:0006807	0.331	nitrogen compound metabolic process
GO:0006996	0.329	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0042579	0.692	microbody
GO:0070013	0.632	intracellular organelle lumen
GO:0031981	0.577	nuclear lumen
GO:0043228	0.546	non-membrane-bounded organelle
GO:0043232	0.543	intracellular non-membrane-bounded organelle
GO:0016020	0.516	membrane
GO:0005777	0.448	peroxisome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13065	0.989	ATP + H2O = ADP + H(+) + phosphate

[back to server]