StarFunc result for job id A3KN83

User Input

>input (1393 residues)
MVEPGQDLLLAALSESGISPNDLFDIDGGDAGLATPMPTPSVQQSVPLSALELGLETEAA
VPVKQEPETVPTPALLNVRQQPPSTTTFVLNQINHLPPLGSTIVMTKTPPVTTNRQTITL
TKFIQTTASTRPSVSAPTVRNAMTSAPSKDQVQLKDLLKNNSLNELMKLKPPANIAQPVA
TAATDVSNGTVKKESSNKEGARMWINDMKMRSFSPTMKVPVVKEDDEPEEEDEEEMGHAE
TYAEYMPIKLKIGLRHPDAVVETSSLSSVTPPDVWYKTSISEETIDNGWLSALQLEAITY
AAQQHETFLPNGDRAGFLIGDGAGVGKGRTIAGIIYENYLLSRKRALWFSVSNDLKYDAE
RDLRDIGAKNILVHSLNKFKYGKISSKHNGSVKKGVIFATYSSLIGESQSGGKYKTRLKQ
LLHWCGDDFDGVIVFDECHKAKNLCPVGSSKPTKTGLAVLELQNKLPKARVVYASATGAS
EPRNMAYMNRLGIWGEGTPFREFSDFIQAVERRGVGAMEIVAMDMKLRGMYIARQLSFTG
VTFKIEEVLLSQSYVKMYNKAVKLWVIARERFQQAADLIDAEQRMKKSMWGQFWSAHQRF
FKYLCIASKVKRVVQLAREEIKNGKCVVIGLQSTGEARTLEALEEGGGELNDFVSTAKGV
LQSLIEKHFPAPDRKKLYSLLGIDLTAPSNNSSPRDSPCKENKIKKRKGEEITREAKKAR
KVGGLTGSSSDDSGSESDASDNEESDYESSKNMSSGDDDDFNPFLDESNEDDENDPWLIR
KDHKKNKEKKKKKSIDPDSIQSALLASGLGSKRPSFSSTPVISPAPNSTPANSNTNSNSS
LITSQDAVERAQQMKKDLLDKLEKLAEDLPPNTLDELIDELGGPENVAEMTGRKGRVVSN
DDGSISYESRSELDVPVEILNITEKQRFMDGDKNIAIISEAASSGISLQADRRAKNQRRR
VHMTLELPWSADRAIQQFGRTHRSNQVTAPEYVFLISELAGEQRFASIVAKRLESLGALT
HGDRRATESRDLSRFNFDNKYGRNALEIVMKSIVNLDSPMVSPPPDYPGEFFKDVRQGLI
GVGLINVEDRSGILTLDKDYNNIGKFLNRILGMEVHQQNALFQYFADTLTAVVQNAKKNG
RYDMGILDLGSGDEKVRKSDVKKFLTPGYSTSGHVELYTISVERGMSWEEATKIWAELTG
PDDGFYLSLQIRNNKKTAILVKEVNPKKKLFLVYRPNTGKQLKLEIYADLKKKYKKVVSD
DALMHWLDQYNSSADTCTHAYWRGNCKKASLGLVCEIGLRCRTYYVLCGSVLSVWTKVEG
VLASVSGTNVKMQIVRLRTEDGQRIVGLIIPANCVSPLVNLLSTSDQSQQLAVQQKQLWQ
QHHPQSITNLSNA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9GQN5	0.251	0.265	2.139E-14	1311	0.111	0.117	Q9GQN5.pdb.gz	ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster OX=7227 GN=XNP PE=1 SV=2
2	PDB:7m8eF	0.184	0.246	2.636E-8	967	0.085	0.123	7m8eF.pdb.gz	Structural basis for activation of Swi2/Snf2 ATPase RapA by RNA polymerase.
3	PDB:7oo3b	0.171	0.400	4.936E-7	534	0.041	0.107	7oo3b.pdb.gz	Structural basis of human transcription-DNA repair coupling.
4	PDB:6g0lW	0.216	0.329	8.447E-7	878	0.074	0.117	6g0lW.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
5	PDB:7epuB	0.151	0.258	9.314E-7	748	0.043	0.080	7epuB.pdb.gz	Structural basis of ALC1/CHD1L autoinhibition and the mechanism of activation by the nucleosome.
6	PDB:5vvrM	0.228	0.555	4.900E-6	503	0.049	0.135	5vvrM.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
7	PDB:6g0lM	0.232	0.362	5.673E-6	855	0.071	0.116	6g0lM.pdb.gz	Structure of the chromatin remodelling enzyme Chd1 bound to a ubiquitinylated nucleosome.
8	AFDB:Q9I920	0.152	0.176	6.195E-6	1183	0.064	0.075	Q9I920.pdb.gz	BLM_CHICK RecQ-like DNA helicase BLM OS=Gallus gallus OX=9031 GN=BLM PE=1 SV=2
9	PDB:6uxwA	0.221	0.375	9.707E-6	778	0.060	0.108	6uxwA.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
10	PDB:8dvsA	0.213	0.389	1.923E-5	682	0.062	0.128	8dvsA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
11	PDB:6tdaS	0.155	0.261	2.019E-5	783	0.040	0.072	6tdaS.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
12	PDB:7yymA	0.159	0.169	2.707E-5	1281	0.078	0.085	7yymA.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
13	AFDB:Q9FNM7	0.195	0.299	3.422E-5	850	0.093	0.153	Q9FNM7.pdb.gz	RH26_ARATH DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana OX=3702 GN=RH26 PE=1 SV=2
14	AFDB:O88700	0.144	0.142	1.089E-2	1416	0.070	0.069	O88700.pdb.gz	BLM_MOUSE RecQ-like DNA helicase BLM OS=Mus musculus OX=10090 GN=Blm PE=1 SV=1
15	AFDB:O43432	0.049	0.045	1.251E-1	1585	0.115	0.101	O43432.pdb.gz	IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2
16	AFDB:F4K2E9	0.120	0.131	2.732E-1	1255	0.065	0.072	F4K2E9.pdb.gz	PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana OX=3702 GN=CUV PE=1 SV=1
17	AFDB:Q99569	0.053	0.059	3.163E-1	1192	0.086	0.101	Q99569.pdb.gz	PKP4_HUMAN Plakophilin-4 OS=Homo sapiens OX=9606 GN=PKP4 PE=1 SV=2
18	AFDB:Q8L7V3	0.057	0.083	1.182	829	0.042	0.071	Q8L7V3.pdb.gz	PMTQ_ARATH Probable methyltransferase PMT26 OS=Arabidopsis thaliana OX=3702 GN=At5g64030 PE=2 SV=1
19	AFDB:Q14669	0.054	0.045	1.437	1992	0.078	0.055	Q14669.pdb.gz	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
20	AFDB:Q9SJQ6	0.045	0.045	1.664	1393	0.108	0.108	Q9SJQ6.pdb.gz	ROS1_ARATH DNA glycosylase/AP lyase ROS1 OS=Arabidopsis thaliana OX=3702 GN=ROS1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8JUV0	0.0	1386	1653	0.509	0.429	SBNO_DROME Protein strawberry notch OS=Drosophila melanogaster OX=7227 GN=sno PE=1 SV=2
2	D6RUV3	0.0	2060	1386	0.793	0.797	D6RUV3_DANRE Protein strawberry notch homolog 1 OS=Danio rerio OX=7955 GN=sbno1 PE=1 SV=1
3	D6RUV4	0.0	592	1350	0.220	0.227	D6RUV4_DANRE Strawberry notch homolog 2a OS=Danio rerio OX=7955 GN=sb:eu274 PE=1 SV=1
4	O01737	0.0	639	1866	0.233	0.174	SBNO_CAEEL Protein strawberry notch homolog OS=Caenorhabditis elegans OX=6239 GN=let-765 PE=1 SV=3
5	Q7TNB8	0.0	622	1349	0.215	0.222	SBNO2_MOUSE Protein strawberry notch homolog 2 OS=Mus musculus OX=10090 GN=Sbno2 PE=1 SV=1
6	Q9Y2G9	0.0	619	1366	0.217	0.221	SBNO2_HUMAN Protein strawberry notch homolog 2 OS=Homo sapiens OX=9606 GN=SBNO2 PE=2 SV=3
7	F4IF36	2.98e-146	481	1295	0.162	0.174	FGT1_ARATH Protein FORGETTER 1 OS=Arabidopsis thaliana OX=3702 GN=FGT1 PE=1 SV=1
8	C6S3C7	1.3	35.4	296	0.016	0.074	C6S3C7_PLAF7 Plasmodium RESA N-terminal domain-containing protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1016600 PE=4 SV=1
9	W0RYD3	5.0	34.3	2135	0.021	0.014	SSG4_ORYSJ Protein SUBSTANDARD STARCH GRAIN 4, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=SSG4 PE=1 SV=1
10	Q7TT18	5.4	33.9	1306	0.019	0.021	MCAF1_MOUSE Activating transcription factor 7-interacting protein 1 OS=Mus musculus OX=10090 GN=Atf7ip PE=1 SV=1
11	Q9ST27	5.4	33.9	907	0.013	0.020	PHOT2_ORYSJ Phototropin-2 OS=Oryza sativa subsp. japonica OX=39947 GN=PHOT2 PE=1 SV=1
12	Q6FRB7	7.7	32.7	287	0.021	0.101	IPYR_CANGA Inorganic pyrophosphatase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=IPP1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13872 AAA_34	1.1e-134	459.7	P-loop containing NTP hydrolase pore-1
2	PF00271 Helicase_C	3.6e+02	12.9	Helicase conserved C-terminal domain
3	PF13871 Helicase_C_4	1.5e-119	410.4	C-terminal domain on Strawberry notch homologue
4	PF04851 ResIII	0.00018	33.0	Type III restriction enzyme, res subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000387361

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000243326	0.830	Telomere-associated protein RIF1
2	9606.ENSP00000265990	0.825	TATA-binding protein-associated factor 172
3	9606.ENSP00000478783	0.824	E3 ubiquitin-protein ligase listerin
4	9606.ENSP00000371193	0.725	Serine/threonine-protein phosphatase CPPED1
5	9606.ENSP00000243903	0.722	Actin-related protein 5
6	9606.ENSP00000363463	0.722	Plays a role in the regulation of neuronal activity.
7	9606.ENSP00000442924	0.699	Histone-lysine N-methyltransferase SETD1B
8	9606.ENSP00000370430	0.697	Patatin-like phospholipase domain-containing protein 4
9	9606.ENSP00000284719	0.695	Obg-like ATPase 1
10	9606.ENSP00000303427	0.672	Sister chromatid cohesion protein PDS5 homolog A
11	9606.ENSP00000396452	0.666	Pseudouridine-5'-phosphatase
12	9606.ENSP00000369162	0.654	Serine/threonine-protein kinase RIO1
13	9606.ENSP00000419279	0.654	Intraflagellar transport protein 56
14	9606.ENSP00000298767	0.650	Wings apart-like protein homolog
15	9606.ENSP00000363583	0.646	Ras-GEF domain-containing family member 1A
16	9606.ENSP00000477507	0.645	Ribosomal oxygenase 1
17	9606.ENSP00000377027	0.639	Transforming growth factor-beta receptor-associated protein 1
18	9606.ENSP00000340454	0.633	Rap1 GTPase-GDP dissociation stimulator 1
19	9606.ENSP00000362456	0.629	Protein PBDC1
20	9606.ENSP00000400839	0.619	Solute carrier family 35 member G2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.709	catalytic activity
GO:0097159	0.476	organic cyclic compound binding
GO:1901363	0.475	heterocyclic compound binding
GO:0003676	0.460	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.992	multicellular organismal process
GO:0048856	0.990	anatomical structure development
GO:0003002	0.942	regionalization
GO:0050789	0.870	regulation of biological process
GO:0009987	0.832	cellular process
GO:0050794	0.806	regulation of cellular process
GO:0009952	0.784	anterior/posterior pattern specification
GO:0048518	0.375	positive regulation of biological process
GO:0048522	0.350	positive regulation of cellular process
GO:0019222	0.345	regulation of metabolic process
GO:0060255	0.328	regulation of macromolecule metabolic process
GO:0050896	0.324	response to stimulus
GO:0080090	0.316	regulation of primary metabolic process
GO:0031323	0.316	regulation of cellular metabolic process
GO:0051171	0.312	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.761	cytoplasm
GO:0070013	0.480	intracellular organelle lumen
GO:0031981	0.308	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]